Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N477

Protein Details
Accession A0A1Y3N477    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-25DSAVKSNKPKNNAIRQQRLKAWQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, plas 8, cyto_nucl 6.5, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005045  CDC50/LEM3_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0033036  P:macromolecule localization  
Pfam View protein in Pfam  
PF03381  CDC50  
Amino Acid Sequences MADSAVKSNKPKNNAIRQQRLKAWQPILTPKNVLPTLFFIGISFIPIGIGLFIATTKVNEFYFEYTDCNTKASKDFSPVEGVSGVQWKFENSTKVCSVQFEIKEDFKKPVFFYYRLTSFYQNHRSYVKSYDSEQLLGEKKVFEDLNSNCDPVRKIENSDVRYFPCGLIANSMFTEIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.8
4 0.82
5 0.84
6 0.82
7 0.79
8 0.75
9 0.74
10 0.68
11 0.61
12 0.57
13 0.6
14 0.56
15 0.51
16 0.46
17 0.39
18 0.43
19 0.39
20 0.35
21 0.26
22 0.27
23 0.28
24 0.26
25 0.24
26 0.16
27 0.17
28 0.16
29 0.16
30 0.11
31 0.07
32 0.06
33 0.06
34 0.06
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.05
43 0.05
44 0.07
45 0.07
46 0.09
47 0.1
48 0.11
49 0.13
50 0.14
51 0.15
52 0.14
53 0.16
54 0.15
55 0.15
56 0.13
57 0.13
58 0.15
59 0.17
60 0.17
61 0.2
62 0.21
63 0.21
64 0.25
65 0.24
66 0.21
67 0.18
68 0.17
69 0.12
70 0.15
71 0.14
72 0.1
73 0.1
74 0.1
75 0.12
76 0.14
77 0.18
78 0.15
79 0.19
80 0.2
81 0.22
82 0.22
83 0.21
84 0.2
85 0.21
86 0.21
87 0.2
88 0.22
89 0.23
90 0.25
91 0.25
92 0.26
93 0.22
94 0.24
95 0.22
96 0.26
97 0.28
98 0.27
99 0.3
100 0.32
101 0.33
102 0.34
103 0.36
104 0.33
105 0.32
106 0.39
107 0.45
108 0.4
109 0.4
110 0.39
111 0.39
112 0.36
113 0.38
114 0.35
115 0.27
116 0.28
117 0.32
118 0.31
119 0.3
120 0.28
121 0.27
122 0.25
123 0.24
124 0.22
125 0.17
126 0.16
127 0.19
128 0.19
129 0.14
130 0.19
131 0.2
132 0.26
133 0.27
134 0.27
135 0.24
136 0.26
137 0.27
138 0.23
139 0.29
140 0.25
141 0.29
142 0.37
143 0.46
144 0.48
145 0.52
146 0.52
147 0.47
148 0.47
149 0.44
150 0.34
151 0.3
152 0.27
153 0.23
154 0.26
155 0.25
156 0.24
157 0.23