Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NDF0

Protein Details
Accession A0A1Y3NDF0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
216-260VEKAKAKAKVKEEKEKAKQEKEKAKAKAKEEKEKAKQEKAKAKGNBasic
NLS Segment(s)
PositionSequence
211-260KEQAKVEKAKAKAKVKEEKEKAKQEKEKAKAKAKEEKEKAKQEKAKAKGN
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF00535  Glycos_transf_2  
CDD cd00761  Glyco_tranf_GTA_type  
Amino Acid Sequences MPTYNAVEFLDRSINSVLNQTLKEIELIIINDASTDNTTDILNKYQKKDPRITIINRGKNGGPSVTRNNGIEIATGEFIGFHDCDDTADSKYFENLYKYSKNYDVVEGMFLSCTNLSDNCLHHIKYQPQGSIYDSIWRRSFLNEHNVRFGEKKMGEDAQFRQDCYKHKPRRYEVPDVGIYYYYKRRSGSLMNFSDKYLEHLNKEAYDQKGKEQAKVEKAKAKAKVKEEKEKAKQEKEKAKAKAKEEKEKAKQEKAKAKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.23
4 0.23
5 0.22
6 0.22
7 0.2
8 0.2
9 0.19
10 0.19
11 0.16
12 0.14
13 0.13
14 0.13
15 0.13
16 0.11
17 0.11
18 0.11
19 0.1
20 0.11
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.11
27 0.13
28 0.19
29 0.26
30 0.3
31 0.34
32 0.41
33 0.47
34 0.52
35 0.58
36 0.57
37 0.59
38 0.62
39 0.62
40 0.65
41 0.69
42 0.7
43 0.63
44 0.6
45 0.52
46 0.46
47 0.43
48 0.36
49 0.29
50 0.27
51 0.32
52 0.33
53 0.34
54 0.31
55 0.31
56 0.29
57 0.26
58 0.22
59 0.16
60 0.14
61 0.12
62 0.11
63 0.09
64 0.08
65 0.08
66 0.09
67 0.08
68 0.06
69 0.06
70 0.06
71 0.07
72 0.09
73 0.1
74 0.1
75 0.11
76 0.12
77 0.12
78 0.13
79 0.14
80 0.14
81 0.15
82 0.15
83 0.19
84 0.22
85 0.23
86 0.26
87 0.27
88 0.28
89 0.26
90 0.26
91 0.22
92 0.19
93 0.18
94 0.15
95 0.12
96 0.1
97 0.08
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.08
104 0.1
105 0.1
106 0.13
107 0.15
108 0.16
109 0.17
110 0.22
111 0.23
112 0.27
113 0.29
114 0.26
115 0.26
116 0.26
117 0.25
118 0.23
119 0.2
120 0.21
121 0.19
122 0.21
123 0.2
124 0.2
125 0.19
126 0.18
127 0.22
128 0.19
129 0.28
130 0.31
131 0.32
132 0.34
133 0.34
134 0.34
135 0.32
136 0.29
137 0.26
138 0.2
139 0.2
140 0.19
141 0.21
142 0.21
143 0.24
144 0.25
145 0.27
146 0.27
147 0.27
148 0.27
149 0.28
150 0.31
151 0.37
152 0.45
153 0.46
154 0.52
155 0.61
156 0.64
157 0.72
158 0.75
159 0.76
160 0.68
161 0.65
162 0.6
163 0.52
164 0.47
165 0.37
166 0.3
167 0.23
168 0.26
169 0.23
170 0.23
171 0.23
172 0.23
173 0.26
174 0.34
175 0.38
176 0.42
177 0.44
178 0.47
179 0.47
180 0.45
181 0.44
182 0.35
183 0.31
184 0.29
185 0.26
186 0.23
187 0.26
188 0.28
189 0.27
190 0.3
191 0.31
192 0.28
193 0.33
194 0.32
195 0.33
196 0.41
197 0.41
198 0.43
199 0.45
200 0.48
201 0.5
202 0.57
203 0.58
204 0.56
205 0.6
206 0.62
207 0.64
208 0.66
209 0.64
210 0.65
211 0.69
212 0.71
213 0.76
214 0.78
215 0.8
216 0.8
217 0.84
218 0.84
219 0.84
220 0.85
221 0.84
222 0.85
223 0.83
224 0.83
225 0.81
226 0.82
227 0.79
228 0.78
229 0.79
230 0.78
231 0.8
232 0.8
233 0.82
234 0.81
235 0.85
236 0.85
237 0.86
238 0.84
239 0.83
240 0.84