Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N5L0

Protein Details
Accession A0A1Y3N5L0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-60DEKPKAPKPAPKVNPKQKTTHydrophilic
NLS Segment(s)
PositionSequence
43-81KPKAPKPAPKVNPKQKTTKLTKSQQRKAEEERRERERKE
Subcellular Location(s) nucl 16, cyto 4, mito 2, pero 2, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013906  eIF3j  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MDDWENEDFDNIKLPAVKNQWDDEDVESEEDIKESWDDSEDEKPKAPKPAPKVNPKQKTTKLTKSQQRKAEEERRERERKEREELENETIEQRKLREAKLVQDADFQNTLDLFGADAVVPKRVSADDASDGEEEEEKEKKIYLEDMKPKTKEEFKKYGEAVYEEISRYDVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.3
4 0.36
5 0.34
6 0.37
7 0.38
8 0.35
9 0.36
10 0.31
11 0.29
12 0.24
13 0.21
14 0.18
15 0.16
16 0.15
17 0.13
18 0.1
19 0.08
20 0.07
21 0.07
22 0.08
23 0.08
24 0.1
25 0.12
26 0.21
27 0.23
28 0.24
29 0.28
30 0.3
31 0.32
32 0.39
33 0.41
34 0.39
35 0.44
36 0.53
37 0.58
38 0.65
39 0.73
40 0.76
41 0.81
42 0.78
43 0.79
44 0.76
45 0.77
46 0.75
47 0.74
48 0.73
49 0.72
50 0.77
51 0.78
52 0.78
53 0.77
54 0.73
55 0.69
56 0.69
57 0.69
58 0.69
59 0.68
60 0.66
61 0.67
62 0.68
63 0.65
64 0.65
65 0.64
66 0.6
67 0.58
68 0.58
69 0.53
70 0.52
71 0.54
72 0.48
73 0.39
74 0.35
75 0.29
76 0.24
77 0.21
78 0.16
79 0.13
80 0.15
81 0.17
82 0.18
83 0.23
84 0.23
85 0.27
86 0.35
87 0.36
88 0.31
89 0.34
90 0.34
91 0.3
92 0.29
93 0.24
94 0.16
95 0.14
96 0.14
97 0.08
98 0.08
99 0.05
100 0.04
101 0.05
102 0.04
103 0.07
104 0.07
105 0.09
106 0.09
107 0.09
108 0.1
109 0.1
110 0.12
111 0.11
112 0.14
113 0.15
114 0.16
115 0.18
116 0.17
117 0.17
118 0.16
119 0.16
120 0.14
121 0.13
122 0.14
123 0.12
124 0.13
125 0.14
126 0.14
127 0.14
128 0.2
129 0.25
130 0.32
131 0.41
132 0.48
133 0.55
134 0.56
135 0.57
136 0.58
137 0.6
138 0.6
139 0.6
140 0.62
141 0.58
142 0.65
143 0.64
144 0.61
145 0.55
146 0.47
147 0.41
148 0.35
149 0.33
150 0.25
151 0.24
152 0.21