Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8Z9K5

Protein Details
Accession H8Z9K5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-73ERMVSIYKDKKRKRCLVNPKKGPFHYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11.833, nucl 10, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR005755  Ribosomal_L13_euk/arc  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MAHGTKLVIDAKDHIVGRLAAYVAKSLREGYSVVVVRSEGLIFSSPIERMVSIYKDKKRKRCLVNPKKGPFHYKEPSKCFKRIVRGMLKYKGAQGAADFARLKTYDGIPMEYELQERVIVPHVLAETKLNPSTKTCTLGEICVRMGWTNAGILEKFENERIKRVSVVQKENEEKEQKKQELLASAAFKKELDSVLASLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.21
5 0.19
6 0.16
7 0.12
8 0.12
9 0.15
10 0.14
11 0.14
12 0.14
13 0.14
14 0.14
15 0.14
16 0.14
17 0.12
18 0.19
19 0.2
20 0.19
21 0.18
22 0.17
23 0.16
24 0.16
25 0.15
26 0.07
27 0.07
28 0.08
29 0.08
30 0.09
31 0.1
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.13
38 0.16
39 0.21
40 0.29
41 0.36
42 0.46
43 0.54
44 0.62
45 0.69
46 0.75
47 0.78
48 0.8
49 0.84
50 0.86
51 0.89
52 0.89
53 0.87
54 0.85
55 0.79
56 0.75
57 0.68
58 0.66
59 0.63
60 0.62
61 0.62
62 0.62
63 0.68
64 0.66
65 0.64
66 0.62
67 0.58
68 0.58
69 0.56
70 0.58
71 0.57
72 0.59
73 0.62
74 0.6
75 0.57
76 0.48
77 0.44
78 0.38
79 0.29
80 0.21
81 0.16
82 0.15
83 0.13
84 0.15
85 0.13
86 0.11
87 0.12
88 0.13
89 0.13
90 0.1
91 0.11
92 0.12
93 0.12
94 0.13
95 0.12
96 0.13
97 0.13
98 0.12
99 0.12
100 0.08
101 0.08
102 0.07
103 0.07
104 0.07
105 0.08
106 0.08
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.1
113 0.09
114 0.12
115 0.15
116 0.14
117 0.15
118 0.17
119 0.22
120 0.23
121 0.26
122 0.23
123 0.24
124 0.24
125 0.27
126 0.27
127 0.23
128 0.22
129 0.18
130 0.18
131 0.14
132 0.14
133 0.11
134 0.09
135 0.08
136 0.08
137 0.09
138 0.09
139 0.1
140 0.1
141 0.11
142 0.12
143 0.16
144 0.23
145 0.23
146 0.29
147 0.31
148 0.31
149 0.32
150 0.37
151 0.42
152 0.43
153 0.5
154 0.5
155 0.55
156 0.59
157 0.61
158 0.62
159 0.62
160 0.56
161 0.57
162 0.62
163 0.56
164 0.52
165 0.52
166 0.48
167 0.45
168 0.45
169 0.42
170 0.37
171 0.37
172 0.36
173 0.33
174 0.28
175 0.24
176 0.24
177 0.2
178 0.17
179 0.17