Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NMK4

Protein Details
Accession A0A1Y3NMK4   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPPKNSKSKVKKKEKVIKPTEKETVEHydrophilic
NLS Segment(s)
PositionSequence
5-16NSKSKVKKKEKV
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005019  Adenine_glyco  
IPR011257  DNA_glycosylase  
Gene Ontology GO:0008725  F:DNA-3-methyladenine glycosylase activity  
GO:0006284  P:base-excision repair  
Pfam View protein in Pfam  
PF03352  Adenine_glyco  
Amino Acid Sequences MPPKNSKSKVKKKEKVIKPTEKETVEINENSEETMQAGLSWIIILEKEENYRKAFDKLNPAAIAKYTPQKIEKLMQNPGIIRNRRKILSIINNAKAFLKVQKEFGTFDKYIWSFTDRKVIDHHLSSEDEMPELSENISKDLKKRGFQFVGPIIIYSYLQAIGIINDHYDYCDYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.9
4 0.9
5 0.85
6 0.84
7 0.81
8 0.72
9 0.63
10 0.55
11 0.49
12 0.44
13 0.37
14 0.32
15 0.26
16 0.24
17 0.23
18 0.2
19 0.15
20 0.1
21 0.1
22 0.08
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.05
32 0.06
33 0.08
34 0.12
35 0.16
36 0.19
37 0.21
38 0.24
39 0.25
40 0.26
41 0.3
42 0.29
43 0.36
44 0.35
45 0.39
46 0.37
47 0.36
48 0.32
49 0.28
50 0.26
51 0.18
52 0.21
53 0.17
54 0.19
55 0.2
56 0.21
57 0.24
58 0.28
59 0.32
60 0.3
61 0.33
62 0.34
63 0.34
64 0.33
65 0.37
66 0.38
67 0.37
68 0.36
69 0.38
70 0.38
71 0.37
72 0.37
73 0.33
74 0.32
75 0.37
76 0.42
77 0.42
78 0.44
79 0.43
80 0.42
81 0.41
82 0.34
83 0.26
84 0.21
85 0.21
86 0.17
87 0.2
88 0.22
89 0.23
90 0.25
91 0.26
92 0.29
93 0.23
94 0.23
95 0.25
96 0.22
97 0.22
98 0.21
99 0.23
100 0.18
101 0.19
102 0.28
103 0.23
104 0.24
105 0.26
106 0.31
107 0.3
108 0.3
109 0.31
110 0.25
111 0.26
112 0.26
113 0.25
114 0.2
115 0.16
116 0.14
117 0.13
118 0.11
119 0.1
120 0.1
121 0.09
122 0.09
123 0.12
124 0.16
125 0.17
126 0.19
127 0.29
128 0.34
129 0.37
130 0.41
131 0.48
132 0.48
133 0.48
134 0.52
135 0.47
136 0.46
137 0.4
138 0.36
139 0.27
140 0.24
141 0.23
142 0.16
143 0.13
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.08
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1