Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NNL2

Protein Details
Accession A0A1Y3NNL2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-90YSKNPIKFLPVQKKEKKEEKEKKANHydrophilic
NLS Segment(s)
PositionSequence
78-90KKEKKEEKEKKAN
Subcellular Location(s) mito 12, plas 6, E.R. 6, cyto_mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MGFMKDDIDFEGQKLTEKLMQLILIVFGVISFIVGFCMQSVRISCYIMLVGIIVTALVILPPWPFYSKNPIKFLPVQKKEKKEEKEKKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.18
5 0.18
6 0.16
7 0.16
8 0.14
9 0.13
10 0.11
11 0.08
12 0.07
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.02
19 0.02
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.05
26 0.06
27 0.07
28 0.09
29 0.1
30 0.1
31 0.1
32 0.1
33 0.1
34 0.08
35 0.07
36 0.04
37 0.03
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.04
49 0.06
50 0.08
51 0.1
52 0.12
53 0.23
54 0.32
55 0.39
56 0.43
57 0.44
58 0.47
59 0.54
60 0.62
61 0.62
62 0.63
63 0.66
64 0.7
65 0.77
66 0.81
67 0.83
68 0.82
69 0.83
70 0.84