Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MY32

Protein Details
Accession A0A1Y3MY32    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
145-168ANRERALKKLREKKEEMRRQRELEBasic
NLS Segment(s)
PositionSequence
147-162RERALKKLREKKEEMR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012923  Csm3  
IPR040038  TIPIN/Csm3/Swi3  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006974  P:DNA damage response  
GO:0000076  P:DNA replication checkpoint signaling  
GO:0031297  P:replication fork processing  
Pfam View protein in Pfam  
PF07962  Swi3  
Amino Acid Sequences KENLNRLINVFQLWGHNLYPRLKFKSIIERTEKICTEAILKKNYADWRSSYRFRKEYETDTYNTSGIIRAEDDPTAEVGGGSFNMDIFKPFPGTQGTTTTNTIPTTTTTTSTINNTNSISSTTPPVPLSRLDHPLTEEEREFMRANRERALKKLREKKEEMRRQRELEQLQKQSQQSVLEQASTSASTSVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.21
4 0.25
5 0.29
6 0.35
7 0.39
8 0.44
9 0.43
10 0.45
11 0.46
12 0.53
13 0.54
14 0.55
15 0.56
16 0.53
17 0.54
18 0.59
19 0.54
20 0.46
21 0.4
22 0.32
23 0.31
24 0.33
25 0.36
26 0.33
27 0.33
28 0.31
29 0.36
30 0.42
31 0.38
32 0.33
33 0.31
34 0.35
35 0.41
36 0.49
37 0.51
38 0.52
39 0.54
40 0.54
41 0.59
42 0.54
43 0.53
44 0.53
45 0.49
46 0.42
47 0.41
48 0.4
49 0.32
50 0.28
51 0.22
52 0.16
53 0.12
54 0.12
55 0.1
56 0.1
57 0.11
58 0.11
59 0.11
60 0.09
61 0.09
62 0.09
63 0.07
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.04
72 0.04
73 0.05
74 0.05
75 0.06
76 0.08
77 0.08
78 0.1
79 0.11
80 0.13
81 0.13
82 0.17
83 0.19
84 0.19
85 0.2
86 0.19
87 0.19
88 0.17
89 0.16
90 0.13
91 0.11
92 0.13
93 0.13
94 0.14
95 0.14
96 0.15
97 0.16
98 0.18
99 0.21
100 0.17
101 0.18
102 0.17
103 0.16
104 0.15
105 0.16
106 0.15
107 0.12
108 0.14
109 0.13
110 0.14
111 0.15
112 0.15
113 0.15
114 0.16
115 0.2
116 0.21
117 0.26
118 0.25
119 0.25
120 0.26
121 0.29
122 0.28
123 0.27
124 0.23
125 0.19
126 0.18
127 0.21
128 0.2
129 0.17
130 0.25
131 0.28
132 0.3
133 0.35
134 0.41
135 0.4
136 0.47
137 0.56
138 0.54
139 0.59
140 0.67
141 0.7
142 0.71
143 0.76
144 0.79
145 0.81
146 0.83
147 0.84
148 0.83
149 0.82
150 0.78
151 0.77
152 0.76
153 0.72
154 0.71
155 0.7
156 0.68
157 0.65
158 0.67
159 0.62
160 0.55
161 0.51
162 0.43
163 0.36
164 0.35
165 0.31
166 0.26
167 0.25
168 0.23
169 0.22
170 0.2
171 0.19