Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NQK8

Protein Details
Accession A0A1Y3NQK8    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
102-126TSQVIQKKVDDKKKDNNNNDTNNSKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, cyto 9, nucl 8, mito 5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012675  Beta-grasp_dom_sf  
IPR012676  TGS-like  
IPR013646  YGR210-like_G4  
Pfam View protein in Pfam  
PF08438  MMR_HSR1_C  
CDD cd04938  TGS_Obg  
Amino Acid Sequences MVLFRYGNTGVVECIRKAVECLNVIPVFPVKNVNNFSSGRFGTKAVFSDCLLVPGGTTVREFARIIHPELDKYYQYAETVGNIRLGEDDLITLDNNIICIKTSQVIQKKVDDKKKDNNNNDTNNSKDKKNDNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.18
5 0.2
6 0.21
7 0.2
8 0.21
9 0.25
10 0.25
11 0.24
12 0.24
13 0.22
14 0.18
15 0.17
16 0.22
17 0.17
18 0.23
19 0.27
20 0.27
21 0.29
22 0.29
23 0.3
24 0.28
25 0.28
26 0.24
27 0.22
28 0.21
29 0.18
30 0.19
31 0.2
32 0.16
33 0.17
34 0.15
35 0.17
36 0.16
37 0.16
38 0.14
39 0.12
40 0.1
41 0.09
42 0.09
43 0.06
44 0.07
45 0.06
46 0.06
47 0.08
48 0.09
49 0.09
50 0.15
51 0.16
52 0.18
53 0.21
54 0.21
55 0.2
56 0.21
57 0.22
58 0.16
59 0.15
60 0.15
61 0.11
62 0.11
63 0.12
64 0.1
65 0.1
66 0.12
67 0.12
68 0.12
69 0.11
70 0.11
71 0.1
72 0.11
73 0.09
74 0.07
75 0.06
76 0.05
77 0.06
78 0.06
79 0.05
80 0.06
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.08
89 0.11
90 0.19
91 0.27
92 0.33
93 0.35
94 0.42
95 0.5
96 0.58
97 0.65
98 0.66
99 0.65
100 0.69
101 0.77
102 0.81
103 0.81
104 0.82
105 0.82
106 0.81
107 0.8
108 0.75
109 0.7
110 0.69
111 0.63
112 0.56
113 0.55