Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NBI8

Protein Details
Accession A0A1Y3NBI8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-136AKPAAVTKGAKNKKNKKNKRKBasic
NLS Segment(s)
PositionSequence
117-136KPAAVTKGAKNKKNKKNKRK
Subcellular Location(s) cyto 10.5, mito 9, cyto_nucl 9, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MLILNLNLNIVDTKPTTPVAKPVEVKETKPATPVPSTPSKANESSSQSKIPKPIKSLAATPATPATPTPSTPVKETPTTKPATPTSSTPSTPVKETPTTKPSSPTSPTAKPTASAAKPAAVTKGAKNKKNKKNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.19
4 0.19
5 0.26
6 0.29
7 0.33
8 0.35
9 0.36
10 0.44
11 0.44
12 0.44
13 0.45
14 0.44
15 0.39
16 0.38
17 0.37
18 0.32
19 0.33
20 0.33
21 0.29
22 0.33
23 0.35
24 0.35
25 0.36
26 0.36
27 0.35
28 0.36
29 0.35
30 0.34
31 0.37
32 0.38
33 0.4
34 0.38
35 0.39
36 0.44
37 0.45
38 0.42
39 0.4
40 0.42
41 0.4
42 0.4
43 0.4
44 0.36
45 0.34
46 0.3
47 0.27
48 0.23
49 0.18
50 0.16
51 0.14
52 0.14
53 0.11
54 0.11
55 0.14
56 0.16
57 0.18
58 0.19
59 0.23
60 0.22
61 0.26
62 0.29
63 0.31
64 0.32
65 0.33
66 0.32
67 0.33
68 0.32
69 0.31
70 0.3
71 0.28
72 0.29
73 0.3
74 0.3
75 0.29
76 0.31
77 0.28
78 0.28
79 0.28
80 0.27
81 0.29
82 0.32
83 0.35
84 0.37
85 0.39
86 0.38
87 0.41
88 0.4
89 0.41
90 0.42
91 0.42
92 0.42
93 0.43
94 0.46
95 0.45
96 0.42
97 0.37
98 0.37
99 0.39
100 0.34
101 0.33
102 0.31
103 0.29
104 0.31
105 0.31
106 0.29
107 0.24
108 0.25
109 0.27
110 0.36
111 0.42
112 0.48
113 0.58
114 0.66
115 0.73
116 0.82