Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MQS5

Protein Details
Accession A0A1Y3MQS5   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-25AKGARVNKIKKNTLKESRRSRSAFHydrophilic
83-104ALMRSKTLTKKKLRQAVKAKRNHydrophilic
NLS Segment(s)
PositionSequence
9-23KIKKNTLKESRRSRS
88-104KTLTKKKLRQAVKAKRN
Subcellular Location(s) nucl 19.5, mito_nucl 13.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAKGARVNKIKKNTLKESRRSRSAFRARSGIASHQAATKGVTVSEVLNNDTMLENRNKKTSDIVKDLLKVNPVNSTKIGKNHALMRSKTLTKKKLRQAVKAKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.82
4 0.84
5 0.82
6 0.83
7 0.78
8 0.73
9 0.74
10 0.75
11 0.71
12 0.64
13 0.61
14 0.53
15 0.52
16 0.49
17 0.41
18 0.35
19 0.3
20 0.27
21 0.23
22 0.23
23 0.2
24 0.18
25 0.16
26 0.11
27 0.1
28 0.1
29 0.08
30 0.08
31 0.1
32 0.1
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.08
39 0.09
40 0.12
41 0.16
42 0.17
43 0.21
44 0.21
45 0.21
46 0.27
47 0.32
48 0.34
49 0.35
50 0.37
51 0.36
52 0.38
53 0.4
54 0.34
55 0.31
56 0.25
57 0.2
58 0.25
59 0.25
60 0.25
61 0.25
62 0.28
63 0.27
64 0.32
65 0.36
66 0.3
67 0.33
68 0.37
69 0.42
70 0.45
71 0.43
72 0.44
73 0.46
74 0.5
75 0.55
76 0.58
77 0.6
78 0.63
79 0.72
80 0.76
81 0.79
82 0.8
83 0.81
84 0.83