Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N6L0

Protein Details
Accession A0A1Y3N6L0   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MHKNKLKKNKNLKNLKEKQQNIKYACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MHKNKLKKNKNLKNLKEKQQNIKYACKQPEIGSTNNRNKKINGNYTKNENHIGNENIKIIEFIDNGSHNYNESKDYNDRNDNGVNCNHRNKQTVKLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.89
4 0.86
5 0.86
6 0.84
7 0.83
8 0.76
9 0.77
10 0.74
11 0.72
12 0.69
13 0.61
14 0.55
15 0.48
16 0.52
17 0.46
18 0.42
19 0.41
20 0.46
21 0.52
22 0.58
23 0.59
24 0.51
25 0.49
26 0.54
27 0.54
28 0.55
29 0.55
30 0.54
31 0.54
32 0.59
33 0.59
34 0.53
35 0.47
36 0.37
37 0.29
38 0.26
39 0.25
40 0.2
41 0.19
42 0.18
43 0.15
44 0.15
45 0.14
46 0.11
47 0.1
48 0.08
49 0.08
50 0.09
51 0.1
52 0.11
53 0.13
54 0.12
55 0.12
56 0.13
57 0.13
58 0.15
59 0.15
60 0.19
61 0.23
62 0.28
63 0.34
64 0.39
65 0.4
66 0.4
67 0.44
68 0.41
69 0.39
70 0.4
71 0.41
72 0.4
73 0.47
74 0.5
75 0.51
76 0.56
77 0.55
78 0.59