Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NSS2

Protein Details
Accession A0A1Y3NSS2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
194-223SETEKRGKSIRNRKNKISREERNNNKKENIHydrophilic
NLS Segment(s)
PositionSequence
198-227KRGKSIRNRKNKISREERNNNKKENIEEKR
Subcellular Location(s) nucl 13, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50088  ANK_REPEAT  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MFQLLKDYANSNNIKLELNGKECINGYYPLLFACKFNNIEMIKLLIDYATEKDIKLELNKKENIGGNFPLLLACDNNNIEIVQFLMDYATNNNIKLLLNEKNNGRWYPLSKACDKNNIEIVKLLINHANKNNIKLELNEKNIHGMYPIIYAGNKNITMVQMLVDYAYENEIILKYEENKIKNYEILAFLKKYISETEKRGKSIRNRKNKISREERNNNKKENIEEKRKEIENQEKLGWLSKTKYSDEIKKLSAGISITATAPPVESVDPNDHHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.29
5 0.3
6 0.32
7 0.28
8 0.29
9 0.28
10 0.29
11 0.25
12 0.21
13 0.19
14 0.17
15 0.17
16 0.16
17 0.18
18 0.16
19 0.14
20 0.15
21 0.2
22 0.2
23 0.2
24 0.27
25 0.25
26 0.26
27 0.26
28 0.25
29 0.19
30 0.18
31 0.17
32 0.09
33 0.09
34 0.09
35 0.1
36 0.11
37 0.11
38 0.11
39 0.13
40 0.14
41 0.16
42 0.21
43 0.27
44 0.3
45 0.38
46 0.4
47 0.4
48 0.43
49 0.46
50 0.41
51 0.38
52 0.33
53 0.26
54 0.24
55 0.23
56 0.19
57 0.14
58 0.12
59 0.09
60 0.08
61 0.11
62 0.11
63 0.11
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.05
75 0.06
76 0.1
77 0.11
78 0.11
79 0.11
80 0.12
81 0.12
82 0.12
83 0.15
84 0.17
85 0.19
86 0.23
87 0.24
88 0.28
89 0.31
90 0.31
91 0.3
92 0.26
93 0.26
94 0.3
95 0.35
96 0.33
97 0.36
98 0.42
99 0.41
100 0.48
101 0.46
102 0.42
103 0.43
104 0.4
105 0.34
106 0.29
107 0.27
108 0.2
109 0.19
110 0.16
111 0.13
112 0.14
113 0.16
114 0.17
115 0.25
116 0.23
117 0.25
118 0.26
119 0.24
120 0.23
121 0.22
122 0.27
123 0.25
124 0.29
125 0.28
126 0.26
127 0.26
128 0.25
129 0.24
130 0.17
131 0.12
132 0.08
133 0.07
134 0.08
135 0.06
136 0.06
137 0.06
138 0.07
139 0.09
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.05
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.05
154 0.04
155 0.04
156 0.05
157 0.05
158 0.06
159 0.06
160 0.07
161 0.08
162 0.15
163 0.19
164 0.2
165 0.23
166 0.25
167 0.25
168 0.26
169 0.25
170 0.21
171 0.21
172 0.23
173 0.23
174 0.21
175 0.21
176 0.2
177 0.19
178 0.18
179 0.18
180 0.2
181 0.21
182 0.27
183 0.36
184 0.39
185 0.42
186 0.44
187 0.48
188 0.53
189 0.6
190 0.63
191 0.65
192 0.68
193 0.76
194 0.83
195 0.84
196 0.84
197 0.83
198 0.83
199 0.83
200 0.87
201 0.87
202 0.88
203 0.86
204 0.82
205 0.76
206 0.7
207 0.67
208 0.67
209 0.66
210 0.66
211 0.64
212 0.63
213 0.65
214 0.64
215 0.6
216 0.59
217 0.6
218 0.56
219 0.55
220 0.51
221 0.46
222 0.44
223 0.46
224 0.39
225 0.32
226 0.28
227 0.3
228 0.33
229 0.32
230 0.39
231 0.4
232 0.48
233 0.52
234 0.54
235 0.5
236 0.48
237 0.47
238 0.4
239 0.36
240 0.27
241 0.22
242 0.18
243 0.17
244 0.15
245 0.15
246 0.15
247 0.12
248 0.11
249 0.1
250 0.11
251 0.11
252 0.11
253 0.15
254 0.21