Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3MS92

Protein Details
Accession A0A1Y3MS92    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28PTFYDPFQVKHRRRTSKKQFSILEKHydrophilic
NLS Segment(s)
PositionSequence
64-71AKAKAQKL
Subcellular Location(s) mito 17, mito_nucl 14, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MWAPTFYDPFQVKHRRRTSKKQFSILEKAFNENPKPNAATRRDLAEQLKMTVRGVQVWFQNRRAKAKAQKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.75
4 0.83
5 0.85
6 0.86
7 0.88
8 0.86
9 0.82
10 0.78
11 0.79
12 0.7
13 0.66
14 0.55
15 0.51
16 0.45
17 0.42
18 0.38
19 0.31
20 0.3
21 0.25
22 0.26
23 0.24
24 0.29
25 0.29
26 0.3
27 0.27
28 0.3
29 0.29
30 0.31
31 0.31
32 0.29
33 0.26
34 0.25
35 0.26
36 0.22
37 0.21
38 0.21
39 0.2
40 0.18
41 0.19
42 0.2
43 0.24
44 0.31
45 0.36
46 0.39
47 0.46
48 0.47
49 0.53
50 0.54
51 0.58
52 0.6