Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NIP9

Protein Details
Accession A0A1Y3NIP9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
231-259QPIEHRINPPEKRKMPRRIRKYSVSLYKYHydrophilic
NLS Segment(s)
PositionSequence
241-250EKRKMPRRIR
Subcellular Location(s) nucl 19, cyto_nucl 13.833, cyto 6.5, cyto_pero 4.166
Family & Domain DBs
Amino Acid Sequences EIDWGDDNLQEDIVYDRIKNNIDYSEDYIPWRSETEELYFNPYGPESVSFEKDLKSKVHDYLNNYNSNLVNGLSYKNRFDVKANISHKIKGEEGDIDEGIIGGGLGVDFEGKKGELTDYFDPEKTWFSLQDVMELTLLHAQQLETMNEDYNKQIDELNKKLKASEEQYLSIKSKKDNGDILKEYQKKILELQDSVNKKNKEIKMLQEENEYYREEIEAQEQVIQTSNITPQPIEHRINPPEKRKMPRRIRKYSVSLYKYIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.18
5 0.21
6 0.22
7 0.22
8 0.22
9 0.25
10 0.28
11 0.31
12 0.31
13 0.3
14 0.31
15 0.31
16 0.29
17 0.26
18 0.23
19 0.2
20 0.18
21 0.19
22 0.21
23 0.23
24 0.22
25 0.28
26 0.27
27 0.26
28 0.25
29 0.23
30 0.19
31 0.15
32 0.17
33 0.14
34 0.17
35 0.2
36 0.21
37 0.22
38 0.24
39 0.25
40 0.26
41 0.24
42 0.26
43 0.27
44 0.3
45 0.37
46 0.39
47 0.43
48 0.5
49 0.53
50 0.51
51 0.48
52 0.46
53 0.38
54 0.35
55 0.28
56 0.18
57 0.13
58 0.1
59 0.13
60 0.15
61 0.17
62 0.17
63 0.2
64 0.21
65 0.22
66 0.24
67 0.29
68 0.29
69 0.37
70 0.38
71 0.42
72 0.42
73 0.44
74 0.43
75 0.38
76 0.34
77 0.25
78 0.24
79 0.19
80 0.19
81 0.18
82 0.16
83 0.13
84 0.12
85 0.1
86 0.08
87 0.06
88 0.04
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.03
98 0.04
99 0.04
100 0.05
101 0.06
102 0.06
103 0.12
104 0.13
105 0.16
106 0.18
107 0.18
108 0.18
109 0.18
110 0.18
111 0.15
112 0.14
113 0.1
114 0.1
115 0.16
116 0.15
117 0.17
118 0.16
119 0.15
120 0.15
121 0.14
122 0.13
123 0.1
124 0.1
125 0.07
126 0.07
127 0.06
128 0.08
129 0.1
130 0.1
131 0.09
132 0.1
133 0.11
134 0.11
135 0.12
136 0.1
137 0.09
138 0.09
139 0.08
140 0.1
141 0.13
142 0.19
143 0.24
144 0.31
145 0.32
146 0.32
147 0.32
148 0.32
149 0.33
150 0.31
151 0.32
152 0.27
153 0.28
154 0.29
155 0.32
156 0.31
157 0.3
158 0.28
159 0.23
160 0.27
161 0.28
162 0.3
163 0.34
164 0.36
165 0.4
166 0.41
167 0.44
168 0.46
169 0.47
170 0.44
171 0.42
172 0.39
173 0.33
174 0.33
175 0.35
176 0.3
177 0.27
178 0.31
179 0.34
180 0.36
181 0.39
182 0.44
183 0.38
184 0.38
185 0.45
186 0.44
187 0.45
188 0.46
189 0.5
190 0.52
191 0.57
192 0.56
193 0.53
194 0.51
195 0.45
196 0.43
197 0.36
198 0.26
199 0.21
200 0.2
201 0.14
202 0.14
203 0.14
204 0.13
205 0.12
206 0.15
207 0.15
208 0.15
209 0.15
210 0.14
211 0.12
212 0.12
213 0.15
214 0.14
215 0.15
216 0.15
217 0.16
218 0.24
219 0.3
220 0.33
221 0.35
222 0.41
223 0.47
224 0.57
225 0.63
226 0.64
227 0.68
228 0.72
229 0.78
230 0.8
231 0.83
232 0.85
233 0.87
234 0.89
235 0.89
236 0.89
237 0.88
238 0.86
239 0.86
240 0.85
241 0.79