Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N106

Protein Details
Accession A0A1Y3N106    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-143NADSKERNSLKRKHKFNKANGNTKRMKHydrophilic
NLS Segment(s)
PositionSequence
126-141LKRKHKFNKANGNTKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024738  Hfi1/Tada1  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
Pfam View protein in Pfam  
PF12767  SAGA-Tad1  
Amino Acid Sequences MILSTPPYPSSNQNDVNSINIKINTTASSATSLKRKDTFQIKQKLSEALGSNSKEYWKCLKNYLTGKLSKNEFDKSMKVLVGDQLQLHNSLIYSIIYNSQRDMVSRDGSSLPLSSANADSKERNSLKRKHKFNKANGNTKRMKLKDEFLSLEKIDRDKIRGLIKVYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.46
4 0.42
5 0.35
6 0.31
7 0.25
8 0.24
9 0.22
10 0.22
11 0.19
12 0.18
13 0.17
14 0.14
15 0.18
16 0.18
17 0.2
18 0.25
19 0.26
20 0.29
21 0.31
22 0.32
23 0.35
24 0.44
25 0.49
26 0.52
27 0.61
28 0.58
29 0.6
30 0.6
31 0.55
32 0.46
33 0.42
34 0.35
35 0.28
36 0.31
37 0.27
38 0.26
39 0.24
40 0.27
41 0.22
42 0.23
43 0.28
44 0.26
45 0.27
46 0.33
47 0.35
48 0.39
49 0.44
50 0.47
51 0.44
52 0.45
53 0.45
54 0.44
55 0.42
56 0.39
57 0.37
58 0.32
59 0.29
60 0.27
61 0.26
62 0.23
63 0.23
64 0.2
65 0.17
66 0.15
67 0.15
68 0.13
69 0.13
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.08
76 0.06
77 0.05
78 0.06
79 0.05
80 0.05
81 0.05
82 0.09
83 0.11
84 0.11
85 0.11
86 0.13
87 0.13
88 0.13
89 0.16
90 0.15
91 0.16
92 0.15
93 0.17
94 0.15
95 0.16
96 0.16
97 0.13
98 0.11
99 0.1
100 0.1
101 0.09
102 0.11
103 0.12
104 0.13
105 0.15
106 0.16
107 0.17
108 0.26
109 0.28
110 0.34
111 0.4
112 0.48
113 0.57
114 0.65
115 0.74
116 0.74
117 0.82
118 0.84
119 0.86
120 0.88
121 0.87
122 0.88
123 0.84
124 0.84
125 0.78
126 0.74
127 0.73
128 0.64
129 0.61
130 0.55
131 0.55
132 0.54
133 0.54
134 0.53
135 0.45
136 0.48
137 0.42
138 0.42
139 0.38
140 0.32
141 0.32
142 0.31
143 0.32
144 0.31
145 0.36
146 0.39
147 0.41