Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NQ74

Protein Details
Accession A0A1Y3NQ74   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRPVWCSSENRKWKRISKPPLYEKVDSHydrophilic
209-234IDEMIRNKKSRKNKSKKKVIFISARVHydrophilic
NLS Segment(s)
PositionSequence
214-226RNKKSRKNKSKKK
Subcellular Location(s) nucl 10.5mito_nucl 10.5, mito 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000834  Peptidase_M14  
Gene Ontology GO:0004181  F:metallocarboxypeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00246  Peptidase_M14  
Amino Acid Sequences MRPVWCSSENRKWKRISKPPLYEKVDSGLQVTFEVMIPPYSNENITYYFAYCVPYTYSDLQHKIAALKTDYFKFLNHNDENNKYSLEYDKYRKEYNDDIKNILNNSNSSTKKSLMHNPKYFWDHLLENDTYDQKDIHELKFSYTDIYFNHRVLTLTNNNLNLDLITISSTKGMITDDYENPNIENIFPNQEEEKIQMFSYCKTQPPSNIDEMIRNKKSRKNKSKKKVIFISARVHPGEVVSSYIADGIIEYLIRDNDIRAKLLRDKYVFKIVPMLNPEGVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.82
4 0.82
5 0.85
6 0.87
7 0.89
8 0.87
9 0.79
10 0.69
11 0.63
12 0.55
13 0.45
14 0.37
15 0.27
16 0.21
17 0.18
18 0.17
19 0.13
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.1
26 0.13
27 0.13
28 0.14
29 0.14
30 0.16
31 0.17
32 0.19
33 0.19
34 0.17
35 0.17
36 0.17
37 0.18
38 0.16
39 0.15
40 0.15
41 0.16
42 0.19
43 0.21
44 0.25
45 0.29
46 0.32
47 0.32
48 0.31
49 0.3
50 0.28
51 0.27
52 0.25
53 0.21
54 0.22
55 0.24
56 0.25
57 0.27
58 0.25
59 0.23
60 0.25
61 0.26
62 0.31
63 0.31
64 0.35
65 0.37
66 0.41
67 0.42
68 0.39
69 0.35
70 0.27
71 0.25
72 0.23
73 0.23
74 0.24
75 0.28
76 0.34
77 0.38
78 0.41
79 0.4
80 0.41
81 0.45
82 0.49
83 0.52
84 0.46
85 0.45
86 0.44
87 0.45
88 0.41
89 0.35
90 0.27
91 0.19
92 0.2
93 0.25
94 0.24
95 0.26
96 0.27
97 0.26
98 0.28
99 0.32
100 0.38
101 0.41
102 0.5
103 0.51
104 0.51
105 0.53
106 0.54
107 0.5
108 0.42
109 0.34
110 0.25
111 0.22
112 0.24
113 0.2
114 0.16
115 0.17
116 0.17
117 0.14
118 0.13
119 0.12
120 0.08
121 0.14
122 0.15
123 0.15
124 0.18
125 0.18
126 0.19
127 0.21
128 0.2
129 0.16
130 0.14
131 0.15
132 0.11
133 0.17
134 0.17
135 0.16
136 0.16
137 0.15
138 0.15
139 0.15
140 0.19
141 0.17
142 0.18
143 0.21
144 0.21
145 0.21
146 0.21
147 0.2
148 0.14
149 0.11
150 0.08
151 0.05
152 0.05
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.06
159 0.06
160 0.05
161 0.08
162 0.11
163 0.14
164 0.17
165 0.18
166 0.18
167 0.17
168 0.18
169 0.15
170 0.12
171 0.12
172 0.1
173 0.13
174 0.13
175 0.15
176 0.15
177 0.16
178 0.16
179 0.17
180 0.17
181 0.15
182 0.14
183 0.15
184 0.15
185 0.15
186 0.21
187 0.21
188 0.23
189 0.26
190 0.29
191 0.32
192 0.36
193 0.41
194 0.39
195 0.4
196 0.37
197 0.4
198 0.45
199 0.49
200 0.49
201 0.48
202 0.49
203 0.53
204 0.63
205 0.67
206 0.71
207 0.73
208 0.79
209 0.86
210 0.92
211 0.92
212 0.92
213 0.89
214 0.87
215 0.85
216 0.8
217 0.76
218 0.7
219 0.66
220 0.57
221 0.48
222 0.39
223 0.3
224 0.26
225 0.19
226 0.15
227 0.11
228 0.1
229 0.1
230 0.1
231 0.09
232 0.07
233 0.06
234 0.05
235 0.05
236 0.05
237 0.05
238 0.07
239 0.07
240 0.09
241 0.09
242 0.1
243 0.17
244 0.19
245 0.22
246 0.21
247 0.27
248 0.34
249 0.41
250 0.47
251 0.44
252 0.48
253 0.51
254 0.59
255 0.55
256 0.47
257 0.5
258 0.44
259 0.45
260 0.45
261 0.43