Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NHT5

Protein Details
Accession A0A1Y3NHT5    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23ANTKKKRSRNPSKIPRPQNCFIIHydrophilic
NLS Segment(s)
PositionSequence
5-11KKRSRNP
85-94PRASKNRRKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences ANTKKKRSRNPSKIPRPQNCFIIYRREKHQIISAKNPGIANNDISKIIAKMWREEPPEVKEIYHQRAKEEAKRHMLANPGYKYTPRASKNRRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.89
4 0.83
5 0.78
6 0.7
7 0.63
8 0.55
9 0.56
10 0.52
11 0.48
12 0.49
13 0.51
14 0.48
15 0.45
16 0.5
17 0.47
18 0.46
19 0.5
20 0.5
21 0.43
22 0.44
23 0.43
24 0.36
25 0.32
26 0.28
27 0.22
28 0.18
29 0.17
30 0.15
31 0.15
32 0.14
33 0.1
34 0.1
35 0.11
36 0.1
37 0.12
38 0.15
39 0.21
40 0.23
41 0.25
42 0.28
43 0.29
44 0.31
45 0.29
46 0.26
47 0.26
48 0.29
49 0.34
50 0.36
51 0.32
52 0.31
53 0.39
54 0.43
55 0.45
56 0.46
57 0.47
58 0.5
59 0.51
60 0.5
61 0.46
62 0.48
63 0.46
64 0.47
65 0.43
66 0.38
67 0.38
68 0.38
69 0.39
70 0.39
71 0.43
72 0.41
73 0.48
74 0.56