Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N693

Protein Details
Accession A0A1Y3N693    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-95EKVKSKKDILKEKFRNRQYPKSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018834  DNA/RNA-bd_Est1-type  
IPR045153  Est1/Ebs1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF10373  EST1_DNA_bind  
Amino Acid Sequences MYSEVSYKNWSIAENYYQMAIQLIPFNGNPFNQLAVIASYELKSTIAIENYMRSLVIRVPFTTSSDNLYLAIEKVKSKKDILKEKFRNRQYPKSFSKAYITSLKGDFLNDYERLISYAYGSTKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.2
5 0.19
6 0.16
7 0.13
8 0.1
9 0.1
10 0.1
11 0.11
12 0.11
13 0.13
14 0.14
15 0.14
16 0.14
17 0.12
18 0.13
19 0.11
20 0.11
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.07
32 0.08
33 0.08
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.07
41 0.07
42 0.08
43 0.11
44 0.11
45 0.11
46 0.13
47 0.14
48 0.16
49 0.17
50 0.15
51 0.15
52 0.15
53 0.15
54 0.12
55 0.12
56 0.1
57 0.09
58 0.1
59 0.08
60 0.1
61 0.13
62 0.16
63 0.18
64 0.21
65 0.25
66 0.33
67 0.43
68 0.48
69 0.56
70 0.63
71 0.71
72 0.78
73 0.8
74 0.82
75 0.79
76 0.82
77 0.79
78 0.78
79 0.75
80 0.72
81 0.68
82 0.6
83 0.59
84 0.5
85 0.47
86 0.45
87 0.4
88 0.37
89 0.35
90 0.34
91 0.28
92 0.27
93 0.23
94 0.17
95 0.2
96 0.17
97 0.17
98 0.16
99 0.16
100 0.16
101 0.16
102 0.14
103 0.11
104 0.15