Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NP98

Protein Details
Accession A0A1Y3NP98   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
144-172RSQYKLMGSKPKNKKPWTREKGLSKEWLFHydrophilic
NLS Segment(s)
PositionSequence
153-160KPKNKKPW
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MNHVWAGKAQKEKVDYDKYLEHSKSYNDLLNISLSSSRNSLSSSMSSLSLNSIGNSSLELAKVSRKLMYPWYHTITRAERKRGSKVWFERAVEEYRKTEVRGLEMISYSSSEEESSSESDEESPKYQRPEGRGKLTAEEKNESRSQYKLMGSKPKNKKPWTREKGLSKEWLFHNDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.44
4 0.47
5 0.46
6 0.51
7 0.47
8 0.41
9 0.35
10 0.36
11 0.35
12 0.33
13 0.32
14 0.24
15 0.24
16 0.23
17 0.22
18 0.2
19 0.17
20 0.17
21 0.14
22 0.15
23 0.15
24 0.15
25 0.14
26 0.15
27 0.15
28 0.14
29 0.14
30 0.15
31 0.15
32 0.15
33 0.15
34 0.14
35 0.13
36 0.12
37 0.11
38 0.1
39 0.09
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.1
49 0.12
50 0.12
51 0.13
52 0.13
53 0.15
54 0.22
55 0.27
56 0.29
57 0.32
58 0.36
59 0.35
60 0.35
61 0.37
62 0.37
63 0.41
64 0.41
65 0.43
66 0.44
67 0.47
68 0.52
69 0.54
70 0.51
71 0.51
72 0.51
73 0.53
74 0.51
75 0.48
76 0.44
77 0.41
78 0.41
79 0.34
80 0.31
81 0.24
82 0.22
83 0.22
84 0.21
85 0.21
86 0.17
87 0.17
88 0.17
89 0.16
90 0.15
91 0.14
92 0.14
93 0.11
94 0.11
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.08
102 0.08
103 0.09
104 0.09
105 0.09
106 0.1
107 0.11
108 0.13
109 0.14
110 0.16
111 0.18
112 0.21
113 0.25
114 0.28
115 0.32
116 0.41
117 0.45
118 0.49
119 0.51
120 0.5
121 0.51
122 0.55
123 0.52
124 0.46
125 0.44
126 0.39
127 0.39
128 0.41
129 0.38
130 0.33
131 0.31
132 0.3
133 0.3
134 0.33
135 0.33
136 0.37
137 0.45
138 0.49
139 0.58
140 0.66
141 0.71
142 0.76
143 0.8
144 0.83
145 0.83
146 0.88
147 0.86
148 0.85
149 0.84
150 0.85
151 0.85
152 0.81
153 0.8
154 0.7
155 0.69
156 0.63
157 0.6