Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NDW1

Protein Details
Accession A0A1Y3NDW1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-79YSYQFKSNKAKENEKKNEKKNQYFLDKRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 12.499, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040441  CFA20/CFAP20DC  
IPR007714  CFA20_dom  
Pfam View protein in Pfam  
PF05018  CFA20_dom  
Amino Acid Sequences MPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRKKNYHQNSNYSYQFKSNKAKENEKKNEKKNQYFLDKRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.14
4 0.17
5 0.17
6 0.19
7 0.19
8 0.19
9 0.18
10 0.18
11 0.25
12 0.24
13 0.26
14 0.24
15 0.23
16 0.23
17 0.22
18 0.2
19 0.14
20 0.12
21 0.11
22 0.12
23 0.21
24 0.29
25 0.36
26 0.37
27 0.4
28 0.43
29 0.49
30 0.57
31 0.57
32 0.59
33 0.59
34 0.64
35 0.66
36 0.69
37 0.66
38 0.58
39 0.5
40 0.46
41 0.44
42 0.42
43 0.46
44 0.46
45 0.51
46 0.55
47 0.65
48 0.67
49 0.74
50 0.79
51 0.8
52 0.84
53 0.84
54 0.87
55 0.87
56 0.88
57 0.86
58 0.84
59 0.84