Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N7H8

Protein Details
Accession A0A1Y3N7H8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
232-258LLKRMNMVKKSKKELREEKEKKISKKIBasic
NLS Segment(s)
PositionSequence
239-258VKKSKKELREEKEKKISKKI
Subcellular Location(s) nucl 15, cyto 6.5, mito 5, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
Amino Acid Sequences MNEKDQNGEFPLLKACTNNNMEMIRLLINYVNKNKTILELNEKNKNNIYPVLLACNNNNIEMLRLFINYANKNKILLEMNQENEDGSYPILLACSNNNIDMAKLLIDYVNKNKIKLELNVKDKYGKYPLIEAFSNNNIEMVQLLINYANKNKIILKLNEVNKKGNYLILLGFKKINSEMINLLMEYSKAKNIVLNLNENDLKNISEISDEMIELLIKYENNINITYENNSELLKRMNMVKKSKKELREEKEKKISKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.28
4 0.3
5 0.31
6 0.3
7 0.29
8 0.29
9 0.27
10 0.26
11 0.19
12 0.16
13 0.15
14 0.14
15 0.18
16 0.23
17 0.3
18 0.32
19 0.31
20 0.32
21 0.32
22 0.32
23 0.33
24 0.31
25 0.34
26 0.39
27 0.45
28 0.53
29 0.54
30 0.54
31 0.52
32 0.49
33 0.42
34 0.36
35 0.33
36 0.27
37 0.27
38 0.3
39 0.29
40 0.29
41 0.26
42 0.3
43 0.28
44 0.24
45 0.24
46 0.17
47 0.16
48 0.15
49 0.16
50 0.1
51 0.1
52 0.1
53 0.12
54 0.19
55 0.22
56 0.26
57 0.29
58 0.28
59 0.29
60 0.28
61 0.29
62 0.25
63 0.23
64 0.25
65 0.26
66 0.27
67 0.27
68 0.27
69 0.23
70 0.2
71 0.19
72 0.12
73 0.08
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.08
82 0.09
83 0.09
84 0.1
85 0.09
86 0.09
87 0.09
88 0.09
89 0.06
90 0.05
91 0.05
92 0.05
93 0.07
94 0.09
95 0.12
96 0.21
97 0.21
98 0.22
99 0.22
100 0.25
101 0.27
102 0.3
103 0.35
104 0.34
105 0.4
106 0.42
107 0.42
108 0.42
109 0.39
110 0.38
111 0.32
112 0.26
113 0.21
114 0.23
115 0.24
116 0.22
117 0.22
118 0.2
119 0.19
120 0.19
121 0.19
122 0.14
123 0.13
124 0.1
125 0.1
126 0.09
127 0.07
128 0.05
129 0.04
130 0.04
131 0.05
132 0.06
133 0.07
134 0.08
135 0.1
136 0.1
137 0.11
138 0.12
139 0.17
140 0.22
141 0.22
142 0.27
143 0.33
144 0.4
145 0.46
146 0.46
147 0.45
148 0.39
149 0.4
150 0.35
151 0.28
152 0.22
153 0.16
154 0.16
155 0.19
156 0.19
157 0.18
158 0.19
159 0.18
160 0.18
161 0.17
162 0.19
163 0.13
164 0.14
165 0.14
166 0.15
167 0.16
168 0.14
169 0.14
170 0.11
171 0.1
172 0.1
173 0.1
174 0.1
175 0.1
176 0.1
177 0.11
178 0.14
179 0.2
180 0.21
181 0.26
182 0.25
183 0.3
184 0.32
185 0.31
186 0.29
187 0.24
188 0.21
189 0.16
190 0.15
191 0.11
192 0.09
193 0.09
194 0.1
195 0.1
196 0.09
197 0.08
198 0.09
199 0.08
200 0.07
201 0.08
202 0.07
203 0.07
204 0.08
205 0.12
206 0.14
207 0.16
208 0.17
209 0.17
210 0.17
211 0.19
212 0.2
213 0.18
214 0.17
215 0.16
216 0.16
217 0.15
218 0.17
219 0.19
220 0.17
221 0.18
222 0.25
223 0.32
224 0.4
225 0.49
226 0.57
227 0.62
228 0.72
229 0.78
230 0.77
231 0.8
232 0.83
233 0.82
234 0.83
235 0.82
236 0.82
237 0.84
238 0.85