Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZE47

Protein Details
Accession H8ZE47    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-115YVPILYRNRYNNKPNKKPNKKPNKKPNKKPNKKPSKEEEKPTEHydrophilic
281-310SEEESEQKKTPPRRNPPRGPNKYRDMKWSKHydrophilic
NLS Segment(s)
PositionSequence
85-109KPNKKPNKKPNKKPNKKPNKKPSKE
289-307KTPPRRNPPRGPNKYRDMK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MRILQIGKTAYAMVTAFSKEKAEERKDSVNLADMQNESLYGLYGNDNCIVIQNCYDECIPNPCCYPEYMPAPYVPILYRNRYNNKPNKKPNKKPNKKPNKKPNKKPSKEEEKPTEEENPSEEEKPTEEEKPSEDEKPGEGVKPGEEKPTEEEKPSEDEKPSEEEKPSEEENPSEEEKPTEEEKPSEDEKPTEEEKPSEEEKPSEEEKPSEEEKPSEEEKPAEEEKPAEEENPSEEEKPTEEEKPSEEEKPSEDEKPSEEEEPSEEEIPSDDDKSYEEEEQSEEESEQKKTPPRRNPPRGPNKYRDMKWSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.14
5 0.16
6 0.15
7 0.22
8 0.3
9 0.35
10 0.39
11 0.43
12 0.5
13 0.5
14 0.51
15 0.46
16 0.42
17 0.39
18 0.34
19 0.32
20 0.25
21 0.24
22 0.22
23 0.2
24 0.15
25 0.11
26 0.1
27 0.07
28 0.07
29 0.09
30 0.09
31 0.11
32 0.12
33 0.12
34 0.11
35 0.15
36 0.16
37 0.14
38 0.15
39 0.16
40 0.15
41 0.17
42 0.18
43 0.15
44 0.15
45 0.22
46 0.22
47 0.22
48 0.24
49 0.23
50 0.24
51 0.25
52 0.27
53 0.26
54 0.3
55 0.3
56 0.29
57 0.28
58 0.3
59 0.28
60 0.25
61 0.19
62 0.21
63 0.22
64 0.27
65 0.33
66 0.38
67 0.45
68 0.51
69 0.61
70 0.64
71 0.71
72 0.76
73 0.81
74 0.84
75 0.88
76 0.91
77 0.92
78 0.94
79 0.94
80 0.94
81 0.94
82 0.95
83 0.94
84 0.95
85 0.95
86 0.95
87 0.95
88 0.95
89 0.95
90 0.95
91 0.91
92 0.89
93 0.88
94 0.88
95 0.84
96 0.82
97 0.79
98 0.74
99 0.68
100 0.62
101 0.58
102 0.48
103 0.41
104 0.33
105 0.29
106 0.24
107 0.23
108 0.21
109 0.15
110 0.15
111 0.18
112 0.19
113 0.18
114 0.17
115 0.16
116 0.18
117 0.21
118 0.23
119 0.21
120 0.2
121 0.18
122 0.17
123 0.2
124 0.19
125 0.15
126 0.13
127 0.12
128 0.13
129 0.16
130 0.16
131 0.17
132 0.16
133 0.17
134 0.21
135 0.27
136 0.26
137 0.23
138 0.24
139 0.21
140 0.26
141 0.27
142 0.24
143 0.18
144 0.18
145 0.18
146 0.22
147 0.22
148 0.2
149 0.18
150 0.17
151 0.17
152 0.2
153 0.2
154 0.18
155 0.17
156 0.15
157 0.15
158 0.18
159 0.19
160 0.16
161 0.15
162 0.14
163 0.14
164 0.17
165 0.18
166 0.17
167 0.16
168 0.16
169 0.18
170 0.21
171 0.23
172 0.22
173 0.21
174 0.19
175 0.2
176 0.23
177 0.24
178 0.22
179 0.21
180 0.2
181 0.2
182 0.24
183 0.25
184 0.23
185 0.22
186 0.2
187 0.2
188 0.24
189 0.25
190 0.23
191 0.22
192 0.2
193 0.2
194 0.24
195 0.25
196 0.23
197 0.22
198 0.2
199 0.2
200 0.24
201 0.25
202 0.23
203 0.22
204 0.2
205 0.2
206 0.25
207 0.26
208 0.22
209 0.2
210 0.19
211 0.19
212 0.22
213 0.21
214 0.16
215 0.14
216 0.14
217 0.16
218 0.18
219 0.19
220 0.16
221 0.16
222 0.16
223 0.16
224 0.19
225 0.18
226 0.17
227 0.17
228 0.17
229 0.18
230 0.22
231 0.24
232 0.23
233 0.22
234 0.21
235 0.22
236 0.27
237 0.28
238 0.27
239 0.25
240 0.23
241 0.23
242 0.27
243 0.27
244 0.23
245 0.21
246 0.18
247 0.2
248 0.24
249 0.25
250 0.22
251 0.19
252 0.17
253 0.17
254 0.19
255 0.19
256 0.16
257 0.13
258 0.12
259 0.13
260 0.17
261 0.19
262 0.18
263 0.17
264 0.17
265 0.19
266 0.2
267 0.21
268 0.18
269 0.16
270 0.19
271 0.2
272 0.22
273 0.23
274 0.27
275 0.34
276 0.42
277 0.52
278 0.58
279 0.67
280 0.76
281 0.84
282 0.89
283 0.92
284 0.94
285 0.95
286 0.93
287 0.91
288 0.9
289 0.89
290 0.82
291 0.81