Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZDQ4

Protein Details
Accession H8ZDQ4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-95LSQSEKKARRKEVKEEKRKERENKISKKDKKMLSRKTRILRKSKNKBasic
NLS Segment(s)
PositionSequence
55-95KKARRKEVKEEKRKERENKISKKDKKMLSRKTRILRKSKNK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFRELVGSESILKSPTPEIEGDAGAAEAEGLQNMRILVRSTREREQPAVLSQSEKKARRKEVKEEKRKERENKISKKDKKMLSRKTRILRKSKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.15
6 0.16
7 0.16
8 0.14
9 0.12
10 0.11
11 0.08
12 0.07
13 0.05
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.05
23 0.07
24 0.08
25 0.13
26 0.18
27 0.22
28 0.26
29 0.3
30 0.32
31 0.33
32 0.33
33 0.3
34 0.27
35 0.25
36 0.21
37 0.19
38 0.18
39 0.23
40 0.29
41 0.33
42 0.38
43 0.43
44 0.52
45 0.6
46 0.65
47 0.69
48 0.73
49 0.78
50 0.82
51 0.84
52 0.86
53 0.86
54 0.89
55 0.86
56 0.86
57 0.86
58 0.85
59 0.86
60 0.86
61 0.87
62 0.86
63 0.88
64 0.86
65 0.84
66 0.84
67 0.84
68 0.85
69 0.85
70 0.86
71 0.86
72 0.88
73 0.89
74 0.88
75 0.88