Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NTS7

Protein Details
Accession A0A1Y3NTS7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
8-28RDIQTKYQRKYKERMEKQYLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010989  SNARE  
IPR045242  Syntaxin  
IPR006012  Syntaxin/epimorphin_CS  
IPR006011  Syntaxin_N  
IPR000727  T_SNARE_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0005484  F:SNAP receptor activity  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00804  Syntaxin  
PROSITE View protein in PROSITE  
PS00914  SYNTAXIN  
PS50192  T_SNARE  
CDD cd15848  SNARE_syntaxin1-like  
Amino Acid Sequences MDTMNKYRDIQTKYQRKYKERMEKQYLVVNPNTTQNEIARLLESGELGQVFAQELIEKGSKSTEAKAALQEVQERHQEIVKIEQSVLELQQLFIDMQVLVKNQGEVINQIECQIITANENTEKGVEELKNAVVYQKKARKQLFTFGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.74
4 0.77
5 0.78
6 0.79
7 0.78
8 0.81
9 0.82
10 0.78
11 0.74
12 0.73
13 0.66
14 0.58
15 0.51
16 0.43
17 0.34
18 0.36
19 0.35
20 0.29
21 0.26
22 0.23
23 0.24
24 0.23
25 0.22
26 0.16
27 0.14
28 0.14
29 0.13
30 0.12
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.07
43 0.08
44 0.08
45 0.08
46 0.08
47 0.1
48 0.11
49 0.12
50 0.14
51 0.15
52 0.16
53 0.16
54 0.17
55 0.17
56 0.16
57 0.18
58 0.15
59 0.16
60 0.16
61 0.16
62 0.15
63 0.15
64 0.16
65 0.13
66 0.18
67 0.17
68 0.16
69 0.15
70 0.15
71 0.15
72 0.14
73 0.14
74 0.1
75 0.08
76 0.07
77 0.07
78 0.08
79 0.07
80 0.06
81 0.07
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.1
93 0.12
94 0.12
95 0.12
96 0.12
97 0.12
98 0.1
99 0.11
100 0.1
101 0.08
102 0.09
103 0.1
104 0.12
105 0.13
106 0.14
107 0.13
108 0.13
109 0.14
110 0.13
111 0.18
112 0.15
113 0.15
114 0.17
115 0.18
116 0.19
117 0.18
118 0.21
119 0.21
120 0.25
121 0.34
122 0.41
123 0.46
124 0.55
125 0.6
126 0.65
127 0.64