Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NG07

Protein Details
Accession A0A1Y3NG07    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-52DEEPKDGKKSPEKKPAKKPTEDDNAcidic
58-80EDKPKDGKKTSEKKPTKKPTEDDBasic
87-107EEPKDGKKTPEKKPAKKPTEEBasic
NLS Segment(s)
PositionSequence
35-46GKKSPEKKPAKK
61-75PKDGKKTSEKKPTKK
92-103GKKTPEKKPAKK
Subcellular Location(s) extr 8E.R. 8, golg 5, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MNSFKFLVLLFLILLPQLIIAADDNESEDEEPKDGKKSPEKKPAKKPTEDDNESEDEEDKPKDGKKTSEKKPTKKPTEDDNESEDEEEPKDGKKTPEKKPAKKPTEEDDNESEDEDVKPKDGKKSPEKKPTEEDDESEDETDEEPTEEDTEEETTDINSEEDEDDDEEPTDDDESEEEEETEETEEETEETEEEEESEEEEEKTTKTTVKKTTTIYRNIYLFNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.06
10 0.07
11 0.08
12 0.08
13 0.1
14 0.1
15 0.11
16 0.11
17 0.12
18 0.14
19 0.14
20 0.18
21 0.2
22 0.26
23 0.35
24 0.43
25 0.51
26 0.61
27 0.7
28 0.76
29 0.84
30 0.88
31 0.86
32 0.85
33 0.8
34 0.79
35 0.79
36 0.73
37 0.65
38 0.58
39 0.52
40 0.45
41 0.41
42 0.32
43 0.22
44 0.21
45 0.19
46 0.15
47 0.15
48 0.18
49 0.22
50 0.24
51 0.31
52 0.39
53 0.49
54 0.57
55 0.65
56 0.72
57 0.75
58 0.83
59 0.86
60 0.85
61 0.83
62 0.78
63 0.76
64 0.77
65 0.73
66 0.65
67 0.59
68 0.52
69 0.45
70 0.42
71 0.32
72 0.23
73 0.18
74 0.16
75 0.12
76 0.1
77 0.11
78 0.13
79 0.16
80 0.25
81 0.33
82 0.41
83 0.51
84 0.61
85 0.68
86 0.77
87 0.83
88 0.81
89 0.78
90 0.73
91 0.68
92 0.69
93 0.61
94 0.55
95 0.47
96 0.42
97 0.37
98 0.33
99 0.27
100 0.17
101 0.15
102 0.13
103 0.1
104 0.08
105 0.11
106 0.12
107 0.19
108 0.23
109 0.3
110 0.39
111 0.49
112 0.58
113 0.66
114 0.69
115 0.65
116 0.66
117 0.65
118 0.62
119 0.54
120 0.46
121 0.4
122 0.38
123 0.35
124 0.29
125 0.23
126 0.15
127 0.14
128 0.13
129 0.09
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.06
136 0.07
137 0.08
138 0.07
139 0.07
140 0.07
141 0.06
142 0.07
143 0.07
144 0.06
145 0.05
146 0.06
147 0.06
148 0.06
149 0.08
150 0.08
151 0.08
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.08
158 0.07
159 0.07
160 0.06
161 0.08
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.09
168 0.1
169 0.08
170 0.07
171 0.07
172 0.07
173 0.07
174 0.08
175 0.08
176 0.07
177 0.07
178 0.08
179 0.07
180 0.07
181 0.09
182 0.08
183 0.08
184 0.09
185 0.1
186 0.1
187 0.11
188 0.12
189 0.11
190 0.13
191 0.13
192 0.17
193 0.22
194 0.3
195 0.38
196 0.44
197 0.49
198 0.54
199 0.62
200 0.66
201 0.68
202 0.66
203 0.64
204 0.6