Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3NR26

Protein Details
Accession A0A1Y3NR26    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
20-44QLPPINKTNEKRKTANRHSRQLSLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042815  DRC10  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005856  C:cytoskeleton  
GO:0031514  C:motile cilium  
Amino Acid Sequences MMNSVLRSELMDNPQPSQNQLPPINKTNEKRKTANRHSRQLSLTELMISESDRSPCYIQRQRIKSVLNELYKKIIIVGLLPDSLERHFINIFDNEVSVVVKKYLEVKNEYLLVRKTNGEINSLYLNEVIKKYKIAIKNVYRTFLFSPDAYLRLMKYQTDNNIKKTIEVQKFEKAVSEILNFLYDKLDTTYEQDVKKQKEIKEITDIELKKKEKVEKYQSILKNAITERYENITNKTRQMEEYKGIFKKIQYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.37
4 0.38
5 0.37
6 0.38
7 0.44
8 0.46
9 0.47
10 0.54
11 0.58
12 0.6
13 0.63
14 0.65
15 0.68
16 0.69
17 0.71
18 0.74
19 0.77
20 0.8
21 0.84
22 0.83
23 0.83
24 0.81
25 0.8
26 0.72
27 0.64
28 0.57
29 0.48
30 0.39
31 0.3
32 0.25
33 0.19
34 0.17
35 0.14
36 0.12
37 0.11
38 0.12
39 0.12
40 0.14
41 0.16
42 0.19
43 0.29
44 0.34
45 0.41
46 0.49
47 0.54
48 0.58
49 0.62
50 0.61
51 0.54
52 0.55
53 0.54
54 0.52
55 0.49
56 0.45
57 0.42
58 0.39
59 0.36
60 0.27
61 0.2
62 0.13
63 0.11
64 0.11
65 0.09
66 0.08
67 0.09
68 0.08
69 0.08
70 0.09
71 0.11
72 0.09
73 0.1
74 0.1
75 0.1
76 0.13
77 0.12
78 0.13
79 0.11
80 0.11
81 0.09
82 0.09
83 0.09
84 0.07
85 0.07
86 0.06
87 0.06
88 0.06
89 0.13
90 0.16
91 0.19
92 0.22
93 0.23
94 0.24
95 0.28
96 0.27
97 0.24
98 0.22
99 0.2
100 0.18
101 0.17
102 0.17
103 0.17
104 0.18
105 0.17
106 0.16
107 0.16
108 0.16
109 0.15
110 0.14
111 0.1
112 0.1
113 0.09
114 0.1
115 0.1
116 0.09
117 0.09
118 0.1
119 0.15
120 0.19
121 0.23
122 0.3
123 0.36
124 0.44
125 0.46
126 0.47
127 0.41
128 0.39
129 0.36
130 0.3
131 0.25
132 0.16
133 0.18
134 0.16
135 0.17
136 0.15
137 0.15
138 0.12
139 0.14
140 0.15
141 0.12
142 0.14
143 0.16
144 0.23
145 0.33
146 0.36
147 0.37
148 0.41
149 0.4
150 0.39
151 0.41
152 0.44
153 0.39
154 0.41
155 0.4
156 0.41
157 0.42
158 0.42
159 0.37
160 0.28
161 0.23
162 0.21
163 0.19
164 0.13
165 0.13
166 0.14
167 0.13
168 0.12
169 0.11
170 0.09
171 0.09
172 0.1
173 0.11
174 0.1
175 0.14
176 0.2
177 0.23
178 0.24
179 0.3
180 0.36
181 0.38
182 0.45
183 0.48
184 0.45
185 0.5
186 0.54
187 0.52
188 0.53
189 0.51
190 0.47
191 0.49
192 0.47
193 0.42
194 0.46
195 0.44
196 0.39
197 0.44
198 0.49
199 0.49
200 0.58
201 0.63
202 0.64
203 0.69
204 0.74
205 0.72
206 0.69
207 0.64
208 0.54
209 0.51
210 0.43
211 0.43
212 0.35
213 0.32
214 0.3
215 0.32
216 0.36
217 0.32
218 0.37
219 0.39
220 0.41
221 0.45
222 0.47
223 0.44
224 0.43
225 0.48
226 0.48
227 0.46
228 0.49
229 0.52
230 0.5
231 0.51
232 0.49