Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3MS97

Protein Details
Accession A0A1Y3MS97   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29STQGKIPKTVKQCKNCYKSKRNSFSYSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 4.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
IPR002909  IPT_dom  
Pfam View protein in Pfam  
PF01833  TIG  
Amino Acid Sequences MSTQGKIPKTVKQCKNCYKSKRNSFSYSYNVYESIKYEHVKAINHYSYTSPVKAKVLKIYNDNKTIDINKNQTSNVSIEELNSIKNNDCNNNFFKIHQLVPNTGPAHGGIQVTIHGQGFYDGLYVVYGNCIIETEFIDSNTLTFYLPPNPKCFHYNGKKTVAEDLFVVDLYKSLISHTEFNTNIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.86
4 0.87
5 0.87
6 0.88
7 0.89
8 0.89
9 0.85
10 0.83
11 0.79
12 0.74
13 0.71
14 0.65
15 0.57
16 0.48
17 0.42
18 0.37
19 0.33
20 0.28
21 0.25
22 0.24
23 0.22
24 0.22
25 0.24
26 0.26
27 0.27
28 0.28
29 0.33
30 0.32
31 0.31
32 0.31
33 0.28
34 0.3
35 0.32
36 0.31
37 0.24
38 0.22
39 0.26
40 0.29
41 0.3
42 0.33
43 0.35
44 0.35
45 0.42
46 0.48
47 0.49
48 0.5
49 0.49
50 0.42
51 0.39
52 0.4
53 0.37
54 0.35
55 0.34
56 0.32
57 0.32
58 0.32
59 0.29
60 0.27
61 0.22
62 0.18
63 0.15
64 0.12
65 0.11
66 0.13
67 0.13
68 0.11
69 0.11
70 0.11
71 0.09
72 0.13
73 0.14
74 0.16
75 0.18
76 0.21
77 0.22
78 0.25
79 0.26
80 0.22
81 0.24
82 0.22
83 0.22
84 0.22
85 0.21
86 0.19
87 0.2
88 0.25
89 0.22
90 0.19
91 0.18
92 0.15
93 0.14
94 0.14
95 0.12
96 0.07
97 0.07
98 0.07
99 0.07
100 0.08
101 0.07
102 0.05
103 0.05
104 0.06
105 0.06
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.09
122 0.09
123 0.1
124 0.11
125 0.1
126 0.1
127 0.1
128 0.1
129 0.07
130 0.07
131 0.08
132 0.16
133 0.23
134 0.26
135 0.3
136 0.33
137 0.35
138 0.38
139 0.41
140 0.44
141 0.48
142 0.55
143 0.57
144 0.62
145 0.62
146 0.6
147 0.64
148 0.54
149 0.44
150 0.35
151 0.3
152 0.22
153 0.2
154 0.19
155 0.1
156 0.09
157 0.09
158 0.1
159 0.07
160 0.08
161 0.12
162 0.14
163 0.19
164 0.21
165 0.27