Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N209

Protein Details
Accession A0A1Y3N209    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
108-138GGIHMLRKHLKKKKKVKKQKFNQQPGYNRDIBasic
NLS Segment(s)
PositionSequence
114-127RKHLKKKKKVKKQK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MYQMPQPGGGYPPPGGYGYPPPGGYAPPPGPGGFPPGPPPPGGYNNYTNQQDDESEYEYITDEDGDYIEDENGNIFTTEEAQNRGLVEPATGERGIGKKILIGGAVLGGIHMLRKHLKKKKKVKKQKFNQQPGYNRDIQAPAYGAPAPAPGYGAPAPGYGAPAPGFGGPAPYGAPYGGPPRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.23
5 0.24
6 0.26
7 0.25
8 0.25
9 0.25
10 0.26
11 0.24
12 0.25
13 0.21
14 0.21
15 0.23
16 0.22
17 0.22
18 0.21
19 0.28
20 0.22
21 0.21
22 0.23
23 0.26
24 0.27
25 0.26
26 0.28
27 0.25
28 0.3
29 0.31
30 0.31
31 0.32
32 0.35
33 0.4
34 0.39
35 0.34
36 0.29
37 0.28
38 0.24
39 0.21
40 0.2
41 0.17
42 0.16
43 0.15
44 0.14
45 0.13
46 0.12
47 0.1
48 0.08
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.07
65 0.1
66 0.1
67 0.12
68 0.12
69 0.13
70 0.13
71 0.13
72 0.11
73 0.09
74 0.08
75 0.06
76 0.06
77 0.08
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.09
84 0.08
85 0.07
86 0.08
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.04
94 0.03
95 0.03
96 0.02
97 0.03
98 0.03
99 0.05
100 0.1
101 0.16
102 0.26
103 0.35
104 0.45
105 0.55
106 0.66
107 0.76
108 0.82
109 0.88
110 0.9
111 0.92
112 0.94
113 0.95
114 0.95
115 0.95
116 0.93
117 0.91
118 0.88
119 0.83
120 0.78
121 0.71
122 0.61
123 0.52
124 0.44
125 0.36
126 0.29
127 0.24
128 0.18
129 0.16
130 0.15
131 0.13
132 0.11
133 0.11
134 0.11
135 0.1
136 0.1
137 0.08
138 0.12
139 0.13
140 0.14
141 0.13
142 0.12
143 0.13
144 0.12
145 0.15
146 0.1
147 0.12
148 0.11
149 0.11
150 0.12
151 0.11
152 0.12
153 0.09
154 0.12
155 0.1
156 0.11
157 0.11
158 0.11
159 0.11
160 0.1
161 0.11
162 0.11