Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NQ18

Protein Details
Accession A0A1Y3NQ18    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-105NTQEKLSKLKNKKKSKANLKNTNKTGHydrophilic
NLS Segment(s)
PositionSequence
87-96KLKNKKKSKA
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MEGNTIVAPVIIPLETIKEYSNTPKEVILNSIQKLEKKIFPKNEQMDILTEVKKRTNTLIIAIVQNTSSIPIKKNIENNNTQEKLSKLKNKKKSKANLKNTNKTGANSNKLVETNSNTCSVIGYLIYSKKDSIIKFAVDPSKRNHGTGWKLLSYSMDRMTNQMPKGHKINLAVDVSRLPAQHLYTKVGFCIKEQINDYYEPGRHAYIMEYFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.12
5 0.13
6 0.15
7 0.24
8 0.29
9 0.28
10 0.28
11 0.3
12 0.32
13 0.31
14 0.33
15 0.31
16 0.31
17 0.3
18 0.35
19 0.35
20 0.35
21 0.37
22 0.38
23 0.37
24 0.38
25 0.46
26 0.49
27 0.52
28 0.6
29 0.61
30 0.62
31 0.58
32 0.53
33 0.46
34 0.41
35 0.38
36 0.32
37 0.29
38 0.25
39 0.27
40 0.27
41 0.26
42 0.25
43 0.27
44 0.24
45 0.24
46 0.27
47 0.25
48 0.25
49 0.24
50 0.21
51 0.16
52 0.15
53 0.12
54 0.1
55 0.11
56 0.11
57 0.12
58 0.17
59 0.21
60 0.24
61 0.32
62 0.38
63 0.42
64 0.46
65 0.5
66 0.53
67 0.51
68 0.47
69 0.42
70 0.35
71 0.35
72 0.35
73 0.4
74 0.41
75 0.49
76 0.59
77 0.68
78 0.75
79 0.79
80 0.83
81 0.85
82 0.85
83 0.87
84 0.87
85 0.86
86 0.87
87 0.8
88 0.75
89 0.65
90 0.55
91 0.52
92 0.46
93 0.4
94 0.32
95 0.31
96 0.26
97 0.25
98 0.25
99 0.19
100 0.17
101 0.16
102 0.16
103 0.17
104 0.16
105 0.15
106 0.15
107 0.14
108 0.1
109 0.07
110 0.06
111 0.07
112 0.09
113 0.1
114 0.11
115 0.11
116 0.13
117 0.17
118 0.17
119 0.2
120 0.2
121 0.2
122 0.21
123 0.25
124 0.3
125 0.27
126 0.3
127 0.29
128 0.37
129 0.36
130 0.36
131 0.34
132 0.35
133 0.39
134 0.42
135 0.42
136 0.33
137 0.33
138 0.32
139 0.32
140 0.27
141 0.25
142 0.22
143 0.2
144 0.19
145 0.22
146 0.26
147 0.29
148 0.28
149 0.3
150 0.3
151 0.32
152 0.36
153 0.37
154 0.36
155 0.34
156 0.35
157 0.36
158 0.36
159 0.31
160 0.28
161 0.25
162 0.24
163 0.23
164 0.2
165 0.15
166 0.16
167 0.18
168 0.23
169 0.25
170 0.27
171 0.29
172 0.29
173 0.29
174 0.31
175 0.29
176 0.25
177 0.32
178 0.29
179 0.32
180 0.35
181 0.36
182 0.34
183 0.35
184 0.37
185 0.33
186 0.32
187 0.29
188 0.28
189 0.25
190 0.22
191 0.21
192 0.21