Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NF48

Protein Details
Accession A0A1Y3NF48   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
126-145QNEKMNIKKKQIKYENSLKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001150  Gly_radical  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF01228  Gly_radical  
Amino Acid Sequences MTLISILLNLERHQFNGSVTYTLFILTVTSNVDDGKKTGSTPDSRKENFLEKMNTLARKLTTINVNVLKRETLENAMAHPKNYSNITISISRYAVNTSPTKRTCEKGNESLVKYLMGHGDSKDIYQNEKMNIKKKQIKYENSLKFESKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.21
4 0.22
5 0.18
6 0.17
7 0.17
8 0.15
9 0.14
10 0.13
11 0.08
12 0.08
13 0.06
14 0.07
15 0.07
16 0.08
17 0.08
18 0.09
19 0.1
20 0.1
21 0.1
22 0.12
23 0.12
24 0.11
25 0.14
26 0.19
27 0.24
28 0.29
29 0.37
30 0.42
31 0.43
32 0.46
33 0.45
34 0.47
35 0.44
36 0.44
37 0.4
38 0.31
39 0.36
40 0.37
41 0.35
42 0.29
43 0.28
44 0.22
45 0.21
46 0.21
47 0.18
48 0.18
49 0.18
50 0.21
51 0.26
52 0.26
53 0.25
54 0.25
55 0.22
56 0.19
57 0.19
58 0.15
59 0.11
60 0.12
61 0.12
62 0.13
63 0.19
64 0.19
65 0.18
66 0.17
67 0.16
68 0.16
69 0.17
70 0.16
71 0.11
72 0.12
73 0.15
74 0.16
75 0.17
76 0.17
77 0.16
78 0.15
79 0.14
80 0.14
81 0.13
82 0.14
83 0.18
84 0.19
85 0.27
86 0.28
87 0.33
88 0.35
89 0.36
90 0.39
91 0.43
92 0.48
93 0.47
94 0.54
95 0.55
96 0.54
97 0.55
98 0.48
99 0.4
100 0.33
101 0.27
102 0.2
103 0.15
104 0.14
105 0.12
106 0.15
107 0.14
108 0.15
109 0.19
110 0.18
111 0.2
112 0.24
113 0.28
114 0.29
115 0.36
116 0.41
117 0.44
118 0.5
119 0.57
120 0.62
121 0.65
122 0.71
123 0.74
124 0.76
125 0.77
126 0.8
127 0.8
128 0.76
129 0.73
130 0.67