Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y3N7G9

Protein Details
Accession A0A1Y3N7G9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKNGKRLKKNGQADKKNIAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR031693  Sin3_C  
Pfam View protein in Pfam  
PF16879  Sin3a_C  
Amino Acid Sequences MKNGKRLKKNGQADKKNIAVKSLVHDVETLHAEQLKKRDNNATYQYSLSFKDATIFGDMKKIIRCYLRHCHTFNESDIKRIIKFLNEFIPKFFHIKNIEDDDDYEDDDEDDVDEEEEEKIETTDESHSTETITENDLSDSKNESINKNSNDLRKKILIKSHENNKMELDNISSTNSTISVLDSGDNENETVDSVFSSVDTQKSKVKLDNAALKIRTCRPIFLLFGNNAFYCFFRLYHKLYERLLNLKNASERMAKEPDQLDLLNPIAVELGFIKKETFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.76
4 0.65
5 0.57
6 0.48
7 0.4
8 0.38
9 0.39
10 0.32
11 0.26
12 0.26
13 0.24
14 0.25
15 0.26
16 0.21
17 0.15
18 0.18
19 0.18
20 0.21
21 0.29
22 0.35
23 0.35
24 0.39
25 0.46
26 0.45
27 0.52
28 0.56
29 0.54
30 0.47
31 0.45
32 0.43
33 0.37
34 0.36
35 0.3
36 0.23
37 0.17
38 0.18
39 0.17
40 0.17
41 0.18
42 0.18
43 0.15
44 0.2
45 0.21
46 0.21
47 0.24
48 0.24
49 0.23
50 0.28
51 0.31
52 0.33
53 0.43
54 0.48
55 0.51
56 0.51
57 0.52
58 0.51
59 0.52
60 0.47
61 0.47
62 0.4
63 0.36
64 0.37
65 0.34
66 0.29
67 0.29
68 0.27
69 0.22
70 0.24
71 0.23
72 0.29
73 0.32
74 0.32
75 0.31
76 0.33
77 0.29
78 0.31
79 0.28
80 0.26
81 0.25
82 0.27
83 0.3
84 0.32
85 0.32
86 0.29
87 0.29
88 0.26
89 0.23
90 0.21
91 0.16
92 0.11
93 0.1
94 0.09
95 0.08
96 0.05
97 0.05
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.05
108 0.05
109 0.05
110 0.07
111 0.08
112 0.09
113 0.09
114 0.09
115 0.09
116 0.1
117 0.1
118 0.09
119 0.1
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.09
126 0.11
127 0.1
128 0.13
129 0.14
130 0.15
131 0.2
132 0.26
133 0.26
134 0.28
135 0.31
136 0.35
137 0.38
138 0.39
139 0.37
140 0.36
141 0.39
142 0.38
143 0.4
144 0.4
145 0.43
146 0.48
147 0.54
148 0.57
149 0.54
150 0.51
151 0.47
152 0.42
153 0.34
154 0.28
155 0.2
156 0.13
157 0.13
158 0.13
159 0.11
160 0.11
161 0.1
162 0.1
163 0.08
164 0.07
165 0.07
166 0.06
167 0.06
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.07
184 0.08
185 0.11
186 0.13
187 0.15
188 0.2
189 0.23
190 0.26
191 0.28
192 0.31
193 0.33
194 0.37
195 0.44
196 0.44
197 0.47
198 0.46
199 0.43
200 0.44
201 0.43
202 0.45
203 0.36
204 0.34
205 0.32
206 0.34
207 0.35
208 0.34
209 0.35
210 0.28
211 0.29
212 0.3
213 0.26
214 0.23
215 0.21
216 0.18
217 0.15
218 0.15
219 0.14
220 0.17
221 0.22
222 0.26
223 0.34
224 0.39
225 0.41
226 0.42
227 0.48
228 0.47
229 0.49
230 0.49
231 0.45
232 0.42
233 0.41
234 0.42
235 0.37
236 0.37
237 0.35
238 0.34
239 0.33
240 0.38
241 0.35
242 0.38
243 0.37
244 0.36
245 0.34
246 0.31
247 0.27
248 0.23
249 0.23
250 0.17
251 0.16
252 0.14
253 0.11
254 0.11
255 0.1
256 0.09
257 0.12
258 0.12
259 0.13