Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3N0X5

Protein Details
Accession A0A1Y3N0X5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-23KTSFWRNIRSKNDYVKNKRDVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF13855  LRR_8  
Amino Acid Sequences MKTSFWRNIRSKNDYVKNKRDVNEECQFVNSLLLKDESYDCCTYDSEKIKCSDNHIIKIQFEEEDIKNFKMPASLGPMNQLEELRLSECQIEGTIPEDIVTLKELNTIRLERNKLTGNIPSSIGSLTKLKWLELEGNKLTGNIPSSIGDLSKLEWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.8
5 0.8
6 0.75
7 0.73
8 0.68
9 0.65
10 0.63
11 0.56
12 0.48
13 0.42
14 0.4
15 0.31
16 0.29
17 0.23
18 0.16
19 0.15
20 0.16
21 0.14
22 0.15
23 0.17
24 0.16
25 0.19
26 0.19
27 0.18
28 0.19
29 0.19
30 0.2
31 0.24
32 0.29
33 0.26
34 0.29
35 0.3
36 0.33
37 0.34
38 0.38
39 0.41
40 0.38
41 0.41
42 0.42
43 0.42
44 0.38
45 0.38
46 0.32
47 0.22
48 0.19
49 0.18
50 0.14
51 0.16
52 0.18
53 0.17
54 0.17
55 0.17
56 0.16
57 0.13
58 0.13
59 0.1
60 0.16
61 0.16
62 0.16
63 0.19
64 0.19
65 0.19
66 0.19
67 0.17
68 0.1
69 0.09
70 0.1
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.05
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.06
89 0.06
90 0.11
91 0.11
92 0.13
93 0.16
94 0.18
95 0.2
96 0.27
97 0.3
98 0.27
99 0.31
100 0.33
101 0.32
102 0.33
103 0.34
104 0.3
105 0.28
106 0.28
107 0.25
108 0.21
109 0.2
110 0.18
111 0.14
112 0.14
113 0.13
114 0.18
115 0.17
116 0.17
117 0.17
118 0.19
119 0.26
120 0.28
121 0.35
122 0.3
123 0.32
124 0.32
125 0.31
126 0.29
127 0.23
128 0.22
129 0.15
130 0.15
131 0.14
132 0.15
133 0.16
134 0.15
135 0.14
136 0.13