Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZC19

Protein Details
Accession H8ZC19    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MARKKAQRVKRKLPNARAEKRFSCHydrophilic
NLS Segment(s)
PositionSequence
3-18RKKAQRVKRKLPNARA
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 11.833, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MARKKAQRVKRKLPNARAEKRFSCLECNREHTVICSIDNSKNRGTAKCTFCEAIHRCTTNRLSQAIDVYADWVDHIEKKSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.89
4 0.85
5 0.82
6 0.73
7 0.67
8 0.62
9 0.53
10 0.51
11 0.47
12 0.45
13 0.42
14 0.46
15 0.45
16 0.41
17 0.39
18 0.32
19 0.3
20 0.26
21 0.22
22 0.18
23 0.17
24 0.21
25 0.24
26 0.25
27 0.22
28 0.25
29 0.27
30 0.26
31 0.29
32 0.32
33 0.32
34 0.31
35 0.33
36 0.3
37 0.28
38 0.37
39 0.35
40 0.32
41 0.34
42 0.34
43 0.32
44 0.37
45 0.4
46 0.37
47 0.37
48 0.33
49 0.3
50 0.3
51 0.31
52 0.26
53 0.24
54 0.18
55 0.16
56 0.14
57 0.12
58 0.1
59 0.09
60 0.1
61 0.13
62 0.15