Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NQR2

Protein Details
Accession A0A1Y3NQR2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-151NENNDNFNNKNKNKNKNKNKNKKKHydrophilic
NLS Segment(s)
PositionSequence
137-151KNKNKNKNKNKNKKK
Subcellular Location(s) nucl 12, cyto_nucl 9.833, mito_nucl 9.333, cyto 6.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences YWNFIGKKIMDKFKRLYGGDENDMNKYLHNALPEEYKIKILLNDNESFNSLYNADLSNRLYIESWKVENGNDDPMDIDHITKNNKNFPNNFKKYCHICDKTNHNTKECWFKVKNKNSIYNKYLTKDKNENNDNFNNKNKNKNKNKNKNKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.55
3 0.52
4 0.51
5 0.52
6 0.5
7 0.51
8 0.45
9 0.39
10 0.4
11 0.34
12 0.26
13 0.22
14 0.21
15 0.17
16 0.17
17 0.16
18 0.16
19 0.2
20 0.21
21 0.21
22 0.19
23 0.18
24 0.17
25 0.16
26 0.18
27 0.19
28 0.23
29 0.25
30 0.27
31 0.27
32 0.27
33 0.28
34 0.25
35 0.21
36 0.17
37 0.12
38 0.1
39 0.09
40 0.1
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.13
50 0.13
51 0.13
52 0.13
53 0.13
54 0.13
55 0.15
56 0.15
57 0.15
58 0.13
59 0.12
60 0.11
61 0.11
62 0.12
63 0.1
64 0.1
65 0.07
66 0.1
67 0.13
68 0.15
69 0.17
70 0.24
71 0.28
72 0.32
73 0.35
74 0.43
75 0.51
76 0.55
77 0.57
78 0.53
79 0.55
80 0.56
81 0.58
82 0.58
83 0.52
84 0.49
85 0.52
86 0.58
87 0.61
88 0.65
89 0.63
90 0.55
91 0.53
92 0.52
93 0.55
94 0.48
95 0.46
96 0.41
97 0.47
98 0.56
99 0.63
100 0.7
101 0.65
102 0.74
103 0.74
104 0.78
105 0.72
106 0.68
107 0.63
108 0.58
109 0.59
110 0.53
111 0.52
112 0.54
113 0.56
114 0.6
115 0.64
116 0.64
117 0.62
118 0.68
119 0.66
120 0.61
121 0.64
122 0.64
123 0.6
124 0.67
125 0.69
126 0.71
127 0.77
128 0.83
129 0.86
130 0.87
131 0.93