Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NIU0

Protein Details
Accession A0A1Y3NIU0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKKNEKSKKENSSNKNEDENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, plas 7, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011527  ABC1_TM_dom  
IPR036640  ABC1_TM_sf  
IPR039421  Type_1_exporter  
Gene Ontology GO:0016020  C:membrane  
GO:0140359  F:ABC-type transporter activity  
GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF00664  ABC_membrane  
PROSITE View protein in PROSITE  
PS50929  ABC_TM1F  
Amino Acid Sequences MKKNEKSKKENSSNKNEDENISFFKLFRYATTTEKIMILISVICSALQGFAVPLTTESLSKIVNIFVSLVVNISLKKITGIEDESILKNIMEFYENPNNQTLNEYSNKYPNINLNNALNSLSSSSNANYDFNDDFKFKPVSILNQEISWHEQTSPGELSSRIVSDAILIEGGMGVKCGDIIHNFSQVLICYVFAFKNGWKLTLGIKKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.69
4 0.61
5 0.55
6 0.49
7 0.43
8 0.39
9 0.34
10 0.27
11 0.27
12 0.27
13 0.23
14 0.2
15 0.21
16 0.2
17 0.24
18 0.27
19 0.27
20 0.25
21 0.25
22 0.24
23 0.18
24 0.15
25 0.12
26 0.09
27 0.08
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.07
42 0.08
43 0.08
44 0.09
45 0.1
46 0.1
47 0.1
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.06
58 0.07
59 0.06
60 0.07
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.09
67 0.11
68 0.11
69 0.12
70 0.14
71 0.14
72 0.14
73 0.13
74 0.11
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.12
81 0.21
82 0.21
83 0.22
84 0.23
85 0.23
86 0.22
87 0.24
88 0.18
89 0.13
90 0.15
91 0.17
92 0.17
93 0.21
94 0.22
95 0.2
96 0.21
97 0.22
98 0.23
99 0.23
100 0.24
101 0.21
102 0.2
103 0.2
104 0.19
105 0.14
106 0.11
107 0.11
108 0.09
109 0.08
110 0.09
111 0.08
112 0.1
113 0.11
114 0.11
115 0.1
116 0.13
117 0.13
118 0.14
119 0.15
120 0.15
121 0.14
122 0.17
123 0.19
124 0.15
125 0.18
126 0.19
127 0.22
128 0.26
129 0.3
130 0.27
131 0.26
132 0.27
133 0.25
134 0.27
135 0.23
136 0.19
137 0.15
138 0.17
139 0.17
140 0.2
141 0.19
142 0.15
143 0.15
144 0.14
145 0.16
146 0.14
147 0.14
148 0.11
149 0.1
150 0.09
151 0.09
152 0.1
153 0.08
154 0.07
155 0.06
156 0.05
157 0.05
158 0.06
159 0.05
160 0.05
161 0.04
162 0.04
163 0.05
164 0.05
165 0.06
166 0.08
167 0.14
168 0.16
169 0.2
170 0.2
171 0.2
172 0.21
173 0.2
174 0.2
175 0.15
176 0.13
177 0.1
178 0.12
179 0.12
180 0.12
181 0.14
182 0.13
183 0.22
184 0.23
185 0.23
186 0.22
187 0.24
188 0.31
189 0.38