Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y3NKU8

Protein Details
Accession A0A1Y3NKU8   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-128LVEKVQQSRKQIKEKKNRSKKFRGTKKATQSKHydrophilic
NLS Segment(s)
PositionSequence
105-128RKQIKEKKNRSKKFRGTKKATQSK
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADATCTIRTRKFMTNRLLQRKQMIVDIIHPNSANLSKSDLRDKLSKMYKADKENIFVFGFRTHFGGGKSTGYALIYDNLEAAKKFEPKYRLVRQGLVEKVQQSRKQIKEKKNRSKKFRGTKKATQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.69
4 0.76
5 0.77
6 0.71
7 0.68
8 0.64
9 0.57
10 0.5
11 0.42
12 0.33
13 0.32
14 0.36
15 0.31
16 0.29
17 0.27
18 0.24
19 0.23
20 0.24
21 0.19
22 0.12
23 0.16
24 0.18
25 0.2
26 0.27
27 0.27
28 0.28
29 0.32
30 0.33
31 0.36
32 0.4
33 0.41
34 0.39
35 0.45
36 0.47
37 0.48
38 0.53
39 0.46
40 0.43
41 0.39
42 0.39
43 0.31
44 0.25
45 0.21
46 0.16
47 0.15
48 0.12
49 0.12
50 0.1
51 0.11
52 0.11
53 0.12
54 0.11
55 0.11
56 0.1
57 0.09
58 0.09
59 0.08
60 0.08
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.1
71 0.14
72 0.16
73 0.21
74 0.25
75 0.3
76 0.4
77 0.46
78 0.52
79 0.51
80 0.54
81 0.52
82 0.56
83 0.54
84 0.48
85 0.42
86 0.36
87 0.4
88 0.43
89 0.43
90 0.43
91 0.49
92 0.55
93 0.63
94 0.69
95 0.73
96 0.77
97 0.84
98 0.88
99 0.9
100 0.92
101 0.91
102 0.93
103 0.93
104 0.93
105 0.93
106 0.92
107 0.9
108 0.9