Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2V118

Protein Details
Accession A0A1Y2V118    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-80ESAGEEPRRRSRRRHRSSSASDREPPKKRSQSRLRDLAAHydrophilic
NLS Segment(s)
PositionSequence
48-76PRRRSRRRHRSSSASDREPPKKRSQSRLR
92-116IKKYHDRQKSKEREKEEKSRDRSGD
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cysk 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024436  DUF3824  
Pfam View protein in Pfam  
PF12868  DUF3824  
Amino Acid Sequences MKESQMMITLIEIEAIQEADRTPGLVPLPGVEYGSEPVELYESAGEEPRRRSRRRHRSSSASDREPPKKRSQSRLRDLAAAGLGTAAAAIGIKKYHDRQKSKEREKEEKSRDRSGDRSLDREDRDRDRERRRYEEEIAGDPYYDYDAGVPPSPPHASGGAYYPPPPQGQGVPYYPPPPQAPDVAGPSGPGGFTQHPNLSTPNVNDYPPHPRYNPQDYVNLPPPNLPPPPPGPPPSGPAPPGAGNRPGPENMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.07
6 0.08
7 0.08
8 0.09
9 0.09
10 0.11
11 0.12
12 0.12
13 0.12
14 0.12
15 0.14
16 0.13
17 0.14
18 0.11
19 0.12
20 0.12
21 0.13
22 0.12
23 0.1
24 0.09
25 0.1
26 0.1
27 0.09
28 0.08
29 0.08
30 0.08
31 0.13
32 0.15
33 0.17
34 0.24
35 0.34
36 0.42
37 0.45
38 0.55
39 0.63
40 0.72
41 0.79
42 0.83
43 0.81
44 0.83
45 0.88
46 0.89
47 0.86
48 0.8
49 0.77
50 0.74
51 0.75
52 0.73
53 0.69
54 0.68
55 0.7
56 0.71
57 0.75
58 0.78
59 0.79
60 0.8
61 0.83
62 0.74
63 0.67
64 0.6
65 0.51
66 0.4
67 0.29
68 0.2
69 0.11
70 0.09
71 0.05
72 0.05
73 0.03
74 0.02
75 0.02
76 0.02
77 0.03
78 0.03
79 0.04
80 0.08
81 0.13
82 0.21
83 0.3
84 0.36
85 0.44
86 0.54
87 0.65
88 0.72
89 0.74
90 0.74
91 0.74
92 0.76
93 0.79
94 0.78
95 0.76
96 0.72
97 0.72
98 0.67
99 0.61
100 0.57
101 0.52
102 0.5
103 0.42
104 0.39
105 0.36
106 0.38
107 0.36
108 0.38
109 0.37
110 0.33
111 0.39
112 0.42
113 0.47
114 0.51
115 0.58
116 0.59
117 0.61
118 0.62
119 0.61
120 0.57
121 0.54
122 0.47
123 0.4
124 0.38
125 0.3
126 0.25
127 0.19
128 0.16
129 0.11
130 0.09
131 0.06
132 0.05
133 0.05
134 0.07
135 0.08
136 0.08
137 0.07
138 0.1
139 0.11
140 0.1
141 0.11
142 0.11
143 0.11
144 0.11
145 0.14
146 0.13
147 0.14
148 0.15
149 0.14
150 0.15
151 0.15
152 0.15
153 0.14
154 0.13
155 0.14
156 0.17
157 0.18
158 0.19
159 0.2
160 0.22
161 0.21
162 0.23
163 0.22
164 0.22
165 0.22
166 0.21
167 0.21
168 0.22
169 0.24
170 0.22
171 0.21
172 0.17
173 0.16
174 0.14
175 0.12
176 0.09
177 0.09
178 0.11
179 0.13
180 0.17
181 0.19
182 0.2
183 0.22
184 0.24
185 0.23
186 0.25
187 0.24
188 0.27
189 0.26
190 0.26
191 0.26
192 0.27
193 0.33
194 0.34
195 0.37
196 0.32
197 0.37
198 0.45
199 0.52
200 0.56
201 0.49
202 0.52
203 0.49
204 0.56
205 0.58
206 0.52
207 0.44
208 0.41
209 0.4
210 0.39
211 0.4
212 0.34
213 0.31
214 0.34
215 0.41
216 0.43
217 0.45
218 0.46
219 0.45
220 0.47
221 0.48
222 0.47
223 0.41
224 0.38
225 0.37
226 0.36
227 0.38
228 0.38
229 0.38
230 0.36
231 0.37
232 0.39