Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2UV67

Protein Details
Accession A0A1Y2UV67    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
390-412AAARAWAKRRSRERMLGARRGVRHydrophilic
NLS Segment(s)
PositionSequence
395-409WAKRRSRERMLGARR
Subcellular Location(s) cyto 9, mito 6, cyto_nucl 6, cysk 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MSLKAIVPLATVPDTDRMRETADLQLDSIFFGKLPLEIRDIIYAECWKASGLKQHILIQGGSLTHWPCTLASQGPDERLEELRRIVQVQEVPLRSHTRALRLDDKWSARFSSPWHEHWGCEEDMRKNAFINVGTYQGRPSHPRRTLFLPILLSCKRMYLEARRSLYSSITLTFTDLAAAHAYLALSRDTVASQLRSLAFSLVLPFDTLHQHRLRSSPAEPAGSWAELCTALSNLVRFAALRDVTIRLGIASTFAGYTNSIDENKTGSIHELFRHDIDVNAWWQVRERWVLSAVRGMLARHLVLQLPRTEPTQRRPTWALPYSYPEYEDGVGSEGVPFRRLERYAALPPMRFRDDGRIEPRMDAPRCAAAPLFPITSNISPRKSWGRLGCAAARAWAKRRSRERMLGARRGVRELVAGFAPNSNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.23
5 0.25
6 0.27
7 0.28
8 0.27
9 0.3
10 0.29
11 0.27
12 0.27
13 0.23
14 0.22
15 0.21
16 0.13
17 0.09
18 0.09
19 0.09
20 0.1
21 0.13
22 0.14
23 0.16
24 0.18
25 0.19
26 0.21
27 0.22
28 0.2
29 0.2
30 0.21
31 0.18
32 0.17
33 0.16
34 0.13
35 0.15
36 0.18
37 0.24
38 0.27
39 0.31
40 0.34
41 0.4
42 0.43
43 0.42
44 0.39
45 0.3
46 0.27
47 0.22
48 0.19
49 0.17
50 0.14
51 0.13
52 0.13
53 0.13
54 0.12
55 0.13
56 0.16
57 0.16
58 0.17
59 0.22
60 0.24
61 0.26
62 0.27
63 0.26
64 0.26
65 0.26
66 0.27
67 0.23
68 0.23
69 0.23
70 0.23
71 0.24
72 0.22
73 0.22
74 0.22
75 0.25
76 0.29
77 0.28
78 0.28
79 0.31
80 0.35
81 0.31
82 0.35
83 0.33
84 0.33
85 0.37
86 0.41
87 0.46
88 0.43
89 0.47
90 0.48
91 0.5
92 0.45
93 0.42
94 0.39
95 0.31
96 0.31
97 0.29
98 0.33
99 0.33
100 0.33
101 0.4
102 0.38
103 0.37
104 0.39
105 0.41
106 0.31
107 0.29
108 0.31
109 0.25
110 0.3
111 0.32
112 0.28
113 0.24
114 0.25
115 0.24
116 0.2
117 0.19
118 0.15
119 0.17
120 0.18
121 0.18
122 0.18
123 0.19
124 0.21
125 0.25
126 0.3
127 0.36
128 0.41
129 0.43
130 0.45
131 0.48
132 0.53
133 0.48
134 0.46
135 0.39
136 0.33
137 0.37
138 0.34
139 0.29
140 0.22
141 0.21
142 0.18
143 0.17
144 0.2
145 0.23
146 0.31
147 0.38
148 0.4
149 0.4
150 0.41
151 0.4
152 0.37
153 0.29
154 0.21
155 0.15
156 0.13
157 0.13
158 0.12
159 0.12
160 0.11
161 0.09
162 0.08
163 0.08
164 0.06
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.07
177 0.08
178 0.08
179 0.08
180 0.1
181 0.1
182 0.1
183 0.1
184 0.09
185 0.08
186 0.08
187 0.08
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.1
194 0.11
195 0.15
196 0.17
197 0.17
198 0.18
199 0.2
200 0.21
201 0.21
202 0.21
203 0.22
204 0.22
205 0.23
206 0.21
207 0.22
208 0.21
209 0.18
210 0.16
211 0.1
212 0.1
213 0.08
214 0.08
215 0.06
216 0.05
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.05
224 0.06
225 0.09
226 0.09
227 0.09
228 0.1
229 0.11
230 0.11
231 0.12
232 0.11
233 0.07
234 0.07
235 0.06
236 0.06
237 0.04
238 0.05
239 0.05
240 0.05
241 0.05
242 0.06
243 0.06
244 0.07
245 0.08
246 0.09
247 0.09
248 0.09
249 0.1
250 0.11
251 0.11
252 0.1
253 0.1
254 0.12
255 0.13
256 0.15
257 0.16
258 0.17
259 0.17
260 0.18
261 0.16
262 0.15
263 0.14
264 0.14
265 0.12
266 0.14
267 0.14
268 0.12
269 0.13
270 0.14
271 0.16
272 0.17
273 0.17
274 0.16
275 0.2
276 0.21
277 0.2
278 0.22
279 0.19
280 0.18
281 0.18
282 0.16
283 0.14
284 0.14
285 0.14
286 0.11
287 0.11
288 0.12
289 0.13
290 0.16
291 0.17
292 0.18
293 0.19
294 0.2
295 0.27
296 0.3
297 0.37
298 0.44
299 0.43
300 0.47
301 0.51
302 0.53
303 0.56
304 0.56
305 0.51
306 0.43
307 0.48
308 0.46
309 0.42
310 0.38
311 0.3
312 0.26
313 0.23
314 0.21
315 0.15
316 0.12
317 0.12
318 0.11
319 0.11
320 0.12
321 0.11
322 0.13
323 0.13
324 0.13
325 0.19
326 0.2
327 0.21
328 0.23
329 0.28
330 0.32
331 0.4
332 0.42
333 0.39
334 0.41
335 0.45
336 0.44
337 0.39
338 0.35
339 0.37
340 0.39
341 0.45
342 0.48
343 0.48
344 0.46
345 0.47
346 0.51
347 0.5
348 0.46
349 0.4
350 0.37
351 0.36
352 0.35
353 0.34
354 0.28
355 0.2
356 0.22
357 0.22
358 0.21
359 0.16
360 0.18
361 0.21
362 0.25
363 0.32
364 0.34
365 0.34
366 0.33
367 0.38
368 0.45
369 0.44
370 0.49
371 0.48
372 0.5
373 0.52
374 0.57
375 0.56
376 0.5
377 0.47
378 0.44
379 0.43
380 0.4
381 0.42
382 0.45
383 0.48
384 0.55
385 0.64
386 0.68
387 0.72
388 0.76
389 0.79
390 0.81
391 0.83
392 0.83
393 0.81
394 0.79
395 0.72
396 0.66
397 0.57
398 0.47
399 0.41
400 0.33
401 0.28
402 0.22
403 0.21
404 0.18