Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2V7Q2

Protein Details
Accession A0A1Y2V7Q2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
224-255ASTNGTPRKAGRPKKDKKAPPSVGRTARKTRSHydrophilic
NLS Segment(s)
PositionSequence
228-254GTPRKAGRPKKDKKAPPSVGRTARKTR
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MADNNTNSIEKGASGDAPAPELQPSDPPAVTGPVNAAEESVEPSIATKTADDSAATAASSEAAAQNDAPATETKEELTEKIDAAEKLAEQPEQPEKPEKPADSAPAQSTTTETTAADAPSVTNGETKEPPKPVAVEDVRDQDLPAVPLSQPVEMTGALPVKEPAKDAPKTAPTPLTPEPEPEKTEASAGEKRKPNEIEASNGDAPAEKPTEDAPAEKKQKTNGASTNGTPRKAGRPKKDKKAPPSVGRTARKTRSQGAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.15
4 0.17
5 0.17
6 0.15
7 0.14
8 0.15
9 0.14
10 0.15
11 0.18
12 0.2
13 0.19
14 0.19
15 0.19
16 0.21
17 0.2
18 0.17
19 0.16
20 0.14
21 0.16
22 0.15
23 0.13
24 0.11
25 0.12
26 0.14
27 0.13
28 0.1
29 0.08
30 0.09
31 0.1
32 0.1
33 0.1
34 0.07
35 0.09
36 0.11
37 0.12
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.09
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.08
57 0.1
58 0.11
59 0.11
60 0.11
61 0.13
62 0.14
63 0.13
64 0.15
65 0.13
66 0.12
67 0.13
68 0.16
69 0.13
70 0.13
71 0.14
72 0.11
73 0.13
74 0.14
75 0.13
76 0.1
77 0.13
78 0.19
79 0.19
80 0.21
81 0.25
82 0.25
83 0.31
84 0.36
85 0.33
86 0.3
87 0.31
88 0.33
89 0.29
90 0.3
91 0.26
92 0.24
93 0.23
94 0.19
95 0.18
96 0.16
97 0.14
98 0.12
99 0.11
100 0.09
101 0.1
102 0.1
103 0.09
104 0.07
105 0.06
106 0.06
107 0.07
108 0.06
109 0.06
110 0.07
111 0.09
112 0.12
113 0.14
114 0.17
115 0.18
116 0.19
117 0.18
118 0.18
119 0.17
120 0.21
121 0.21
122 0.19
123 0.2
124 0.22
125 0.22
126 0.21
127 0.21
128 0.14
129 0.14
130 0.12
131 0.1
132 0.08
133 0.07
134 0.09
135 0.1
136 0.1
137 0.09
138 0.08
139 0.09
140 0.08
141 0.09
142 0.08
143 0.09
144 0.08
145 0.09
146 0.09
147 0.09
148 0.1
149 0.11
150 0.13
151 0.18
152 0.19
153 0.2
154 0.25
155 0.29
156 0.31
157 0.32
158 0.32
159 0.26
160 0.32
161 0.33
162 0.33
163 0.27
164 0.3
165 0.33
166 0.33
167 0.34
168 0.3
169 0.28
170 0.24
171 0.24
172 0.21
173 0.22
174 0.25
175 0.26
176 0.32
177 0.36
178 0.37
179 0.43
180 0.44
181 0.41
182 0.43
183 0.41
184 0.39
185 0.37
186 0.43
187 0.36
188 0.34
189 0.31
190 0.23
191 0.22
192 0.2
193 0.18
194 0.11
195 0.11
196 0.12
197 0.17
198 0.17
199 0.19
200 0.21
201 0.3
202 0.37
203 0.39
204 0.42
205 0.42
206 0.49
207 0.49
208 0.52
209 0.49
210 0.48
211 0.49
212 0.49
213 0.55
214 0.52
215 0.5
216 0.43
217 0.4
218 0.44
219 0.51
220 0.57
221 0.58
222 0.64
223 0.73
224 0.83
225 0.9
226 0.89
227 0.89
228 0.9
229 0.89
230 0.88
231 0.86
232 0.85
233 0.85
234 0.83
235 0.82
236 0.8
237 0.78
238 0.77
239 0.74
240 0.72