Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UKV4

Protein Details
Accession A0A1Y2UKV4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-116LDRLEARIRRLQRKNEEKKRQKEKERKESSKKHRPBasic
NLS Segment(s)
PositionSequence
88-116RIRRLQRKNEEKKRQKEKERKESSKKHRP
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MATLEERKTVVKNVLTQISVFNESLQTWEENVNSEVLPDNDTEEIKKWLEWQWESHNSLRLFDYGPTSTQLRGDLSRALSDLDRLEARIRRLQRKNEEKKRQKEKERKESSKKHRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.34
4 0.33
5 0.3
6 0.29
7 0.24
8 0.19
9 0.16
10 0.16
11 0.17
12 0.16
13 0.13
14 0.11
15 0.13
16 0.12
17 0.13
18 0.14
19 0.13
20 0.11
21 0.11
22 0.11
23 0.1
24 0.11
25 0.09
26 0.09
27 0.09
28 0.1
29 0.1
30 0.11
31 0.13
32 0.12
33 0.12
34 0.13
35 0.16
36 0.21
37 0.21
38 0.23
39 0.27
40 0.32
41 0.35
42 0.35
43 0.37
44 0.32
45 0.32
46 0.29
47 0.23
48 0.18
49 0.16
50 0.17
51 0.11
52 0.12
53 0.13
54 0.13
55 0.13
56 0.13
57 0.13
58 0.12
59 0.12
60 0.13
61 0.14
62 0.14
63 0.14
64 0.13
65 0.14
66 0.12
67 0.12
68 0.12
69 0.11
70 0.11
71 0.11
72 0.16
73 0.18
74 0.22
75 0.28
76 0.35
77 0.43
78 0.51
79 0.59
80 0.66
81 0.73
82 0.81
83 0.85
84 0.89
85 0.9
86 0.92
87 0.94
88 0.93
89 0.93
90 0.93
91 0.93
92 0.93
93 0.94
94 0.94
95 0.93
96 0.94