Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2V5R8

Protein Details
Accession A0A1Y2V5R8    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
32-54WTSKKVSAMKKKAEKKHAKEYEKBasic
NLS Segment(s)
PositionSequence
38-54SAMKKKAEKKHAKEYEK
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MQAAAQARLARSRARFQQGLNDARDVHADLEWTSKKVSAMKKKAEKKHAKEYEKARERYPSPDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.42
4 0.5
5 0.52
6 0.53
7 0.47
8 0.41
9 0.34
10 0.32
11 0.32
12 0.23
13 0.16
14 0.11
15 0.09
16 0.08
17 0.12
18 0.12
19 0.12
20 0.12
21 0.12
22 0.13
23 0.18
24 0.26
25 0.32
26 0.39
27 0.48
28 0.58
29 0.66
30 0.74
31 0.79
32 0.82
33 0.79
34 0.82
35 0.83
36 0.79
37 0.78
38 0.78
39 0.79
40 0.78
41 0.73
42 0.66
43 0.64
44 0.61