Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UIA8

Protein Details
Accession A0A1Y2UIA8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKTPWRLSRFQKARQRRRLRSVDAVHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRATNTLFGGLLWKTPWRLSRFQKARQRRRLRSVDAVVATLDNALAKQGETLKALETWKETMPTEAEMLPKDKYTMFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.14
5 0.15
6 0.19
7 0.26
8 0.28
9 0.36
10 0.42
11 0.52
12 0.58
13 0.66
14 0.73
15 0.77
16 0.83
17 0.85
18 0.89
19 0.86
20 0.88
21 0.86
22 0.82
23 0.8
24 0.72
25 0.66
26 0.56
27 0.48
28 0.38
29 0.29
30 0.23
31 0.14
32 0.1
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.06
40 0.07
41 0.08
42 0.08
43 0.09
44 0.1
45 0.11
46 0.11
47 0.11
48 0.12
49 0.12
50 0.13
51 0.13
52 0.12
53 0.13
54 0.13
55 0.13
56 0.12
57 0.13
58 0.12
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.38
69 0.44
70 0.54
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79