Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2VDP2

Protein Details
Accession A0A1Y2VDP2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
25-44NYCSVATRDRTRRNNRTDAIHydrophilic
132-152GSSSERQKGHRSSRCHHRRQRBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MDVTPPRPIKPCNFALRTGSRQRPNYCSVATRDRTRRNNRTDAIWRDRPCIMCEKRQLKQVLDENWHSFMRRNFRKLTEPEITLFQENRDEIFEENYYWDWSELHANFIDDIRHEIQVKYGSGRYEEGESQGSSSERQKGHRSSRCHHRRQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.59
4 0.6
5 0.62
6 0.63
7 0.62
8 0.66
9 0.68
10 0.66
11 0.64
12 0.61
13 0.54
14 0.49
15 0.47
16 0.48
17 0.48
18 0.52
19 0.56
20 0.61
21 0.69
22 0.75
23 0.79
24 0.77
25 0.8
26 0.73
27 0.72
28 0.71
29 0.7
30 0.68
31 0.66
32 0.6
33 0.55
34 0.56
35 0.49
36 0.42
37 0.43
38 0.38
39 0.37
40 0.45
41 0.48
42 0.48
43 0.54
44 0.55
45 0.46
46 0.5
47 0.49
48 0.44
49 0.42
50 0.41
51 0.36
52 0.36
53 0.35
54 0.28
55 0.25
56 0.23
57 0.29
58 0.32
59 0.34
60 0.34
61 0.37
62 0.44
63 0.43
64 0.46
65 0.39
66 0.35
67 0.32
68 0.32
69 0.3
70 0.24
71 0.22
72 0.16
73 0.15
74 0.13
75 0.13
76 0.11
77 0.11
78 0.1
79 0.12
80 0.12
81 0.1
82 0.11
83 0.11
84 0.11
85 0.1
86 0.1
87 0.08
88 0.09
89 0.14
90 0.13
91 0.15
92 0.15
93 0.15
94 0.15
95 0.15
96 0.15
97 0.09
98 0.13
99 0.13
100 0.15
101 0.16
102 0.15
103 0.18
104 0.21
105 0.22
106 0.2
107 0.21
108 0.2
109 0.21
110 0.22
111 0.2
112 0.2
113 0.2
114 0.19
115 0.2
116 0.19
117 0.17
118 0.18
119 0.17
120 0.16
121 0.19
122 0.25
123 0.25
124 0.3
125 0.38
126 0.46
127 0.56
128 0.61
129 0.65
130 0.66
131 0.75
132 0.8