Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2V7N5

Protein Details
Accession A0A1Y2V7N5    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-34AANRTKSTTKSNKDKKVPNEERTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020708  DNA-dir_RNA_polK_14-18kDa_CS  
IPR006110  Pol_omega/Rpo6/RPB6  
IPR028363  RPB6  
IPR036161  RPB6/omega-like_sf  
IPR006111  Rpo6/Rpb6  
Gene Ontology GO:0005665  C:RNA polymerase II, core complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF01192  RNA_pol_Rpb6  
PROSITE View protein in PROSITE  
PS01111  RNA_POL_K_14KD  
Amino Acid Sequences ENVVISGDPSAAANRTKSTTKSNKDKKVPNEERTTTPYMTKYERARVLGTRALQISMNAPVLVDLEGESDPLQIAIKELREKKIPLIVRRYLPDGYYEDWSCEELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.22
4 0.25
5 0.34
6 0.41
7 0.48
8 0.58
9 0.66
10 0.72
11 0.77
12 0.83
13 0.82
14 0.83
15 0.83
16 0.8
17 0.78
18 0.72
19 0.67
20 0.64
21 0.6
22 0.49
23 0.42
24 0.37
25 0.31
26 0.31
27 0.33
28 0.3
29 0.32
30 0.34
31 0.34
32 0.33
33 0.32
34 0.32
35 0.3
36 0.27
37 0.23
38 0.2
39 0.18
40 0.16
41 0.15
42 0.12
43 0.1
44 0.1
45 0.07
46 0.07
47 0.06
48 0.07
49 0.07
50 0.06
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.06
60 0.04
61 0.06
62 0.07
63 0.1
64 0.17
65 0.2
66 0.24
67 0.28
68 0.3
69 0.31
70 0.37
71 0.42
72 0.42
73 0.47
74 0.49
75 0.5
76 0.52
77 0.53
78 0.46
79 0.4
80 0.37
81 0.32
82 0.29
83 0.3
84 0.27
85 0.25
86 0.25