Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UP80

Protein Details
Accession A0A1Y2UP80   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-42GALKLKGGKVQKTKKKKKTKTLNLERALSTHydrophilic
NLS Segment(s)
PositionSequence
16-32KLKGGKVQKTKKKKKTK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPADEYASVGGGGALKLKGGKVQKTKKKKKTKTLNLERALSTEDDSSAEEVARSRLDDGKDEGGVDVVERKTEAERRHEEANRKKMLKMLEDPKVASEFRKTHKERVEGLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.14
6 0.19
7 0.28
8 0.36
9 0.47
10 0.57
11 0.67
12 0.78
13 0.83
14 0.89
15 0.91
16 0.92
17 0.93
18 0.93
19 0.93
20 0.94
21 0.93
22 0.87
23 0.8
24 0.7
25 0.59
26 0.5
27 0.39
28 0.29
29 0.19
30 0.14
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.08
42 0.11
43 0.12
44 0.13
45 0.15
46 0.15
47 0.15
48 0.15
49 0.13
50 0.1
51 0.09
52 0.07
53 0.08
54 0.06
55 0.06
56 0.06
57 0.07
58 0.09
59 0.14
60 0.17
61 0.22
62 0.26
63 0.3
64 0.37
65 0.41
66 0.49
67 0.53
68 0.6
69 0.6
70 0.57
71 0.54
72 0.51
73 0.49
74 0.45
75 0.44
76 0.42
77 0.41
78 0.42
79 0.41
80 0.39
81 0.38
82 0.33
83 0.27
84 0.27
85 0.25
86 0.29
87 0.39
88 0.41
89 0.47
90 0.55
91 0.59
92 0.57
93 0.61
94 0.63
95 0.55
96 0.54
97 0.53
98 0.46
99 0.42
100 0.38
101 0.29
102 0.22
103 0.21
104 0.22
105 0.21
106 0.23
107 0.28
108 0.33
109 0.34