Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2V532

Protein Details
Accession A0A1Y2V532    Localization Confidence High Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-55RELIPGFHPPKKPNKKNPKKGKVKPGNINWIKKRABasic
243-267KSDSTNTKQGKARKKRDEPSESSDSHydrophilic
NLS Segment(s)
PositionSequence
19-61AKRELIPGFHPPKKPNKKNPKKGKVKPGNINWIKKRARTIERR
95-97KRK
111-113RKK
217-229RKLGKESKSRRST
234-243KDTKAKSSAK
249-258TKQGKARKKR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MGSKRKFSEVDSDPSEKGAKRELIPGFHPPKKPNKKNPKKGKVKPGNINWIKKRARTIERRFKTGQNMPANVQNDLERELAHHLQKIEEAADEKKRKTMIKKYHMVRFFERKKADRLAKQIKSQLKTATDKKEIEKLNADLHKAEIDSIYTRYFPYRERYISLYPVASLGLSVQGGEKKEDASTAAQALHTERPSIWEDIEKASEKGIQALIEIRERKLGKESKSRRSTEQSSKDTKAKSSAKSDSTNTKQGKARKKRDEPSESSDSSDSEGGFFEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.37
4 0.34
5 0.34
6 0.32
7 0.3
8 0.38
9 0.4
10 0.4
11 0.41
12 0.49
13 0.5
14 0.52
15 0.56
16 0.55
17 0.62
18 0.69
19 0.77
20 0.78
21 0.81
22 0.85
23 0.9
24 0.95
25 0.95
26 0.95
27 0.94
28 0.94
29 0.94
30 0.92
31 0.91
32 0.88
33 0.89
34 0.86
35 0.86
36 0.8
37 0.79
38 0.74
39 0.68
40 0.67
41 0.65
42 0.67
43 0.68
44 0.73
45 0.74
46 0.74
47 0.77
48 0.73
49 0.69
50 0.68
51 0.64
52 0.62
53 0.59
54 0.56
55 0.51
56 0.54
57 0.51
58 0.42
59 0.36
60 0.28
61 0.21
62 0.21
63 0.2
64 0.13
65 0.13
66 0.17
67 0.2
68 0.2
69 0.21
70 0.19
71 0.19
72 0.2
73 0.19
74 0.15
75 0.12
76 0.13
77 0.14
78 0.22
79 0.26
80 0.25
81 0.28
82 0.31
83 0.35
84 0.41
85 0.48
86 0.5
87 0.55
88 0.63
89 0.66
90 0.7
91 0.71
92 0.67
93 0.62
94 0.62
95 0.59
96 0.58
97 0.58
98 0.53
99 0.52
100 0.56
101 0.58
102 0.53
103 0.57
104 0.59
105 0.58
106 0.59
107 0.62
108 0.59
109 0.54
110 0.51
111 0.45
112 0.4
113 0.41
114 0.43
115 0.43
116 0.42
117 0.42
118 0.41
119 0.44
120 0.4
121 0.36
122 0.33
123 0.28
124 0.29
125 0.29
126 0.28
127 0.21
128 0.2
129 0.18
130 0.15
131 0.14
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.09
139 0.1
140 0.11
141 0.13
142 0.17
143 0.21
144 0.22
145 0.24
146 0.28
147 0.29
148 0.31
149 0.3
150 0.24
151 0.19
152 0.18
153 0.15
154 0.1
155 0.08
156 0.05
157 0.05
158 0.04
159 0.04
160 0.05
161 0.07
162 0.08
163 0.09
164 0.1
165 0.1
166 0.1
167 0.1
168 0.11
169 0.1
170 0.1
171 0.11
172 0.11
173 0.1
174 0.11
175 0.13
176 0.15
177 0.14
178 0.14
179 0.12
180 0.16
181 0.18
182 0.19
183 0.18
184 0.16
185 0.18
186 0.19
187 0.23
188 0.21
189 0.18
190 0.18
191 0.19
192 0.16
193 0.17
194 0.16
195 0.12
196 0.11
197 0.14
198 0.16
199 0.2
200 0.21
201 0.2
202 0.26
203 0.26
204 0.27
205 0.32
206 0.37
207 0.38
208 0.47
209 0.55
210 0.59
211 0.67
212 0.7
213 0.68
214 0.7
215 0.72
216 0.71
217 0.73
218 0.7
219 0.69
220 0.71
221 0.7
222 0.64
223 0.58
224 0.57
225 0.54
226 0.51
227 0.52
228 0.54
229 0.53
230 0.56
231 0.58
232 0.58
233 0.58
234 0.61
235 0.56
236 0.56
237 0.56
238 0.6
239 0.67
240 0.68
241 0.72
242 0.74
243 0.82
244 0.84
245 0.89
246 0.89
247 0.86
248 0.83
249 0.8
250 0.7
251 0.63
252 0.55
253 0.45
254 0.38
255 0.32
256 0.24
257 0.17
258 0.16