Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2VCQ6

Protein Details
Accession A0A1Y2VCQ6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-96DPTRRRKYDMQLPPKTKRKPKAQQKSTVQARAQHydrophilic
NLS Segment(s)
PositionSequence
77-84PKTKRKPK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MTYNDSKPDFYAVLDLPRDADETEIRSAFRQLSLKYHPDRQGSSSVASHENFLQLTEAYETLRDPTRRRKYDMQLPPKTKRKPKAQQKSTVQARAQENWNRSPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.18
5 0.19
6 0.14
7 0.15
8 0.12
9 0.14
10 0.17
11 0.17
12 0.16
13 0.16
14 0.18
15 0.16
16 0.18
17 0.19
18 0.17
19 0.22
20 0.27
21 0.33
22 0.35
23 0.41
24 0.43
25 0.43
26 0.43
27 0.4
28 0.39
29 0.34
30 0.32
31 0.26
32 0.22
33 0.22
34 0.2
35 0.18
36 0.14
37 0.13
38 0.11
39 0.1
40 0.09
41 0.06
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.08
49 0.13
50 0.15
51 0.18
52 0.29
53 0.39
54 0.43
55 0.5
56 0.56
57 0.59
58 0.67
59 0.74
60 0.74
61 0.73
62 0.77
63 0.8
64 0.81
65 0.82
66 0.81
67 0.8
68 0.8
69 0.81
70 0.85
71 0.87
72 0.87
73 0.88
74 0.88
75 0.89
76 0.87
77 0.85
78 0.76
79 0.72
80 0.67
81 0.62
82 0.62
83 0.59
84 0.55