Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UAC4

Protein Details
Accession A0A1Y2UAC4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
224-244SLYFFRKRTTPLKKRYILKLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000305  GIY-YIG_endonuc  
IPR035901  GIY-YIG_endonuc_sf  
IPR006350  Intron_endoG1  
IPR003647  Intron_nuc_1_rpt  
IPR010896  NUMOD1  
Gene Ontology GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF01541  GIY-YIG  
PF07453  NUMOD1  
PROSITE View protein in PROSITE  
PS50164  GIY_YIG  
CDD cd10445  GIY-YIG_bI1_like  
Amino Acid Sequences SGKSYIGSSKNLSLRFKQYFNYNHISHPKRNLRIYKALLKYGYSGFKLEILEYCDVSLLLQREQYYFDVLNPEYNILKVAGSPLGYRHSEAAKKLIGLSAKALHGKTLDKEHIEKIRKGNTFSKSIFITNNDTGDSLEFSSMTEAGSYLGISRVSVRNYILKDKPFKGYRYKLSKIETSLDVSSKIKKNTKKIEVTDITTNEVNIYSSFTLAAKALGVTQSTLSLYFFRKRTTPLKKRYILKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.51
4 0.47
5 0.5
6 0.51
7 0.53
8 0.55
9 0.48
10 0.5
11 0.57
12 0.6
13 0.57
14 0.62
15 0.65
16 0.65
17 0.72
18 0.73
19 0.7
20 0.73
21 0.74
22 0.73
23 0.67
24 0.65
25 0.57
26 0.49
27 0.45
28 0.4
29 0.37
30 0.29
31 0.26
32 0.21
33 0.22
34 0.22
35 0.2
36 0.18
37 0.17
38 0.17
39 0.16
40 0.16
41 0.13
42 0.12
43 0.12
44 0.13
45 0.11
46 0.11
47 0.13
48 0.13
49 0.14
50 0.16
51 0.17
52 0.17
53 0.15
54 0.15
55 0.17
56 0.17
57 0.19
58 0.17
59 0.17
60 0.14
61 0.14
62 0.14
63 0.1
64 0.1
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.09
71 0.12
72 0.13
73 0.14
74 0.14
75 0.17
76 0.19
77 0.2
78 0.22
79 0.19
80 0.19
81 0.18
82 0.19
83 0.15
84 0.13
85 0.14
86 0.13
87 0.13
88 0.15
89 0.15
90 0.13
91 0.14
92 0.15
93 0.15
94 0.17
95 0.18
96 0.17
97 0.19
98 0.23
99 0.3
100 0.32
101 0.34
102 0.34
103 0.39
104 0.39
105 0.41
106 0.44
107 0.39
108 0.4
109 0.38
110 0.36
111 0.29
112 0.29
113 0.26
114 0.21
115 0.24
116 0.19
117 0.19
118 0.17
119 0.16
120 0.15
121 0.14
122 0.13
123 0.07
124 0.06
125 0.06
126 0.05
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.04
133 0.05
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.08
140 0.1
141 0.11
142 0.13
143 0.14
144 0.17
145 0.2
146 0.26
147 0.28
148 0.31
149 0.36
150 0.38
151 0.45
152 0.45
153 0.46
154 0.49
155 0.53
156 0.56
157 0.59
158 0.62
159 0.6
160 0.59
161 0.6
162 0.53
163 0.49
164 0.42
165 0.36
166 0.33
167 0.28
168 0.26
169 0.23
170 0.28
171 0.29
172 0.34
173 0.38
174 0.43
175 0.52
176 0.6
177 0.68
178 0.69
179 0.68
180 0.71
181 0.68
182 0.65
183 0.62
184 0.53
185 0.47
186 0.39
187 0.35
188 0.26
189 0.22
190 0.18
191 0.11
192 0.14
193 0.1
194 0.1
195 0.11
196 0.11
197 0.11
198 0.11
199 0.11
200 0.07
201 0.07
202 0.08
203 0.09
204 0.09
205 0.09
206 0.09
207 0.1
208 0.1
209 0.11
210 0.11
211 0.13
212 0.17
213 0.23
214 0.25
215 0.27
216 0.29
217 0.36
218 0.45
219 0.54
220 0.6
221 0.63
222 0.72
223 0.77
224 0.81