Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2VAR8

Protein Details
Accession A0A1Y2VAR8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31PKEATKRGKAGKVEKRKGKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
6-28TKRGKAGKVEKRKGKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEATKRGKAGKVEKRKGKKDPNAPKRGLSAYMFFANEQRENVRDENPGISFGQVGKILGERWKALNDKQRAPYEAKAAADKKRYEDEKQAYQVSANVYSPLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.84
4 0.85
5 0.87
6 0.87
7 0.86
8 0.86
9 0.87
10 0.88
11 0.88
12 0.82
13 0.74
14 0.67
15 0.6
16 0.52
17 0.43
18 0.34
19 0.27
20 0.27
21 0.25
22 0.2
23 0.2
24 0.19
25 0.18
26 0.17
27 0.16
28 0.14
29 0.17
30 0.19
31 0.18
32 0.17
33 0.17
34 0.17
35 0.16
36 0.16
37 0.13
38 0.12
39 0.1
40 0.08
41 0.09
42 0.07
43 0.07
44 0.06
45 0.07
46 0.07
47 0.1
48 0.11
49 0.11
50 0.12
51 0.15
52 0.17
53 0.22
54 0.3
55 0.33
56 0.39
57 0.44
58 0.47
59 0.46
60 0.49
61 0.46
62 0.42
63 0.4
64 0.35
65 0.34
66 0.35
67 0.38
68 0.41
69 0.39
70 0.39
71 0.44
72 0.47
73 0.46
74 0.52
75 0.52
76 0.54
77 0.58
78 0.56
79 0.48
80 0.45
81 0.42
82 0.36
83 0.32
84 0.24