Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2VLX9

Protein Details
Accession A0A1Y2VLX9    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AAKKHVPIVKKRTKSFNRHQSDRFKCLSSSWRKPKGIDNRVRRRFRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, mito_nucl 13.833, nucl 6.5, cyto_nucl 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKSFNRHQSDRFKCLSSSWRKPKGIDNRVRRRFRGNMTMPSIGFGSNKKTRHMMPSGHKAFLVNNTKDVELLLMHNRTYAAEIAHNVSSRKRIDIIARAKQLGVKVTNPKAKVTTEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.83
4 0.84
5 0.84
6 0.83
7 0.81
8 0.83
9 0.83
10 0.81
11 0.78
12 0.7
13 0.61
14 0.52
15 0.48
16 0.5
17 0.49
18 0.52
19 0.56
20 0.62
21 0.62
22 0.63
23 0.69
24 0.7
25 0.71
26 0.7
27 0.7
28 0.72
29 0.8
30 0.83
31 0.76
32 0.72
33 0.68
34 0.64
35 0.63
36 0.58
37 0.54
38 0.54
39 0.54
40 0.46
41 0.41
42 0.35
43 0.25
44 0.2
45 0.14
46 0.16
47 0.19
48 0.21
49 0.21
50 0.24
51 0.25
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.33
63 0.35
64 0.25
65 0.25
66 0.26
67 0.26
68 0.25
69 0.24
70 0.17
71 0.09
72 0.11
73 0.12
74 0.12
75 0.12
76 0.13
77 0.13
78 0.12
79 0.13
80 0.12
81 0.09
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.17
89 0.22
90 0.22
91 0.23
92 0.22
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47